(data stored in ACNUC7421 zone)

EMBL: CP001825.PE368

CP001825.PE368       Location/Qualifiers
FT   CDS_pept        403265..404026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0370"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bha:BH0166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41292"
FT                   /db_xref="GOA:D1CED6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACZ41292.1"
FT                   /translation="MDPYYLYIDRDSIFHRLDPRTKMLLLLVTFVLVFISLNPLYLLAI
FT                   LLLVLLAGYVAGVLVNLRRIRFVLFMITLVTIVLWSLFQQGTTPLFWIVERESVVYAVS
FT                   VAIRIDTMVIAGLIFLSITRNEDIAMALVRIGIPYRFAFVVSTALRLVPTIASTTTTIT
FT                   QAQRSRGLDLDTGGPIQRIKNYIPLLIPVFISTIRSTNIFSMALESKGFGAMPSRTYYL
FT                   QLKMVGRDFVVIFIALGLLVFIILARILGYL"
     atggatccct attatttgta tatagatcgg gattcaatat tccataggct tgatcctcgt        60
     accaagatgc tgctgctcct ggtaaccttt gtgttagttt tcatctctct gaaccctctt       120
     tatttgttag ccatattgtt gttggtttta ctagctggtt atgtagctgg ggtgttggtc       180
     aaccttcgga ggattaggtt tgtattgttc atgataactc tggtgaccat agtcctttgg       240
     tctttgttcc agcagggaac tactccccta ttctggatcg tagagcgtga atccgtcgtt       300
     tacgccgtat ctgtggctat tagaatagac accatggtta tagctggcct gatctttctt       360
     tctataactc gtaacgaaga catagccatg gcgctagtaa ggataggtat accatatagg       420
     tttgcttttg tggtctcgac agccttgcgc ctggtcccga cgatagcctc cactactacc       480
     accatcaccc aagcacagag atctagaggg ttggatcttg acacgggagg cccaatccaa       540
     aggataaaaa actacatccc cttgttaata cctgttttca tctctacaat aagatccacc       600
     aatatattca gtatggcgct agagtccaag gggtttgggg cgatgccaag tcgtacctac       660
     tatctacagt tgaagatggt aggaagggac tttgtagtta tattcattgc tctaggttta       720
     ttggtattca tcatattagc tcgtatcttg ggatatctat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page