(data stored in ACNUC7421 zone)

EMBL: CP001825.PE37

CP001825.PE37        Location/Qualifiers
FT   CDS_pept        38399..38956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0038"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: sus:Acid_7933 adenylylsulfate kinase /
FT                   phosphoadenylylsulfate reductase (thioredoxin); TIGRFAM:
FT                   adenylylsulfate kinase; PFAM: adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40961"
FT                   /db_xref="GOA:D1CDF5"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF5"
FT                   /inference="protein motif:TFAM:TIGR00455"
FT                   /protein_id="ACZ40961.1"
FT                   /translation="MDQKGFTVWFTGLSGAGKTTLADRLEPILRERGLKVEKLDGDVVR
FT                   THLSKGLGFSKEDRDTNIRRIAFVAQLLTRNGVAVITSAISPYRETRQEAREMIGNFVE
FT                   VYVKCSIEELARRDVKGLYAKALRGEIPNFTGISDPYEEPLNPEIVVDSEKETVEESLN
FT                   KIVTRLEELGYLPKVDVAVGAK"
     ttggatcaaa aaggctttac ggtttggttt actggacttt caggtgctgg caagactacc        60
     cttgctgatc gccttgagcc aatcctcagg gaaagaggac tcaaagttga gaagctagat       120
     ggggatgtgg ttaggaccca cctatcaaag ggactgggct tttctaaaga ggatagagat       180
     accaacatac gtcgcatagc ctttgtggca caactgttga ctaggaacgg cgtagcagtt       240
     ataaccagcg ctatatctcc ttacagagag acaaggcaag aagctagaga gatgataggt       300
     aatttcgtgg aagtgtacgt caagtgctcc atagaagaac tcgctagaag agatgtaaaa       360
     ggtctatatg ctaaggctct gagaggagag atccccaact ttactggcat atccgacccc       420
     tacgaggaac ctctaaatcc tgaaatagtc gtagattcgg agaaagaaac cgttgaggaa       480
     agcctcaata agatagtaac ccgccttgaa gagctaggat acctccctaa ggtagatgtt       540
     gccgtagggg caaagtag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page