(data stored in ACNUC7421 zone)

EMBL: CP001825.PE371

CP001825.PE371       Location/Qualifiers
FT   CDS_pept        405461..405889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0373"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101; KEGG:
FT                   cbd:CBUD_1267 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41295"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED9"
FT                   /inference="protein motif:PFAM:PF01951"
FT                   /protein_id="ACZ41295.1"
FT                   /translation="MGNMSDIYDYEYFDHDADVGIVGRGSSLESAFESAAKAMFAVMLD
FT                   LEAVKPEKEVVFEFEEEDPELALFTWLNKLLVLAREYDLALGKFHLVRQGNKWIGKAWG
FT                   QPWSTDLERGTEVKGATFTMLSVEQENGVWQARCVVDV"
     atggggaata tgagcgatat ttatgactac gagtactttg atcacgatgc agatgttggc        60
     atagtaggca ggggaagttc gctagagtcg gccttcgaat ctgccgcaaa ggctatgttc       120
     gcggtcatgc tggatttaga agcagttaag ccggaaaaag aagtagtttt tgaattcgag       180
     gaagaagatc cagagcttgc cttatttacc tggcttaaca agcttctggt cttagctcga       240
     gagtatgatc tggcgctagg aaagtttcat ttggttaggc aaggtaataa gtggataggt       300
     aaggcatggg gacagccctg gagcacggac cttgaacgtg gaactgaagt gaaaggggct       360
     actttcacta tgctttcggt cgagcaggag aatggagtgt ggcaggctag gtgcgtagta       420
     gatgtatag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page