(data stored in ACNUC7421 zone)

EMBL: CP001825.PE372

CP001825.PE372       Location/Qualifiers
FT   CDS_pept        405908..407341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0374"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   nmu:Nmul_A0903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41296"
FT                   /db_xref="GOA:D1CEE0"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE0"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACZ41296.1"
FT                   /translation="MDLSKLEKIDEYTWTVPLKPGEKRAPVVLYGTKELLRSMDDKVLE
FT                   QITNVAKLPGIVGKAMTMPDAHWGYGFPIGGVAAFDPEEGGIISAGGVGFDISCGIRCL
FT                   RTDLSLRDLEPYAERLADELYKTIPAGVGEEGEIKLSPKELDRVLEGGAEWAVREGYGV
FT                   PEDLEYIEEHGRMEGAVPEFVSKEAKKRQKGEMGTLGSGNHYLEVQVVEKVYDQKAAEA
FT                   FGLWEGQIVVSIHCGSRGLGHQIGTDYLLSLAKAAQRLKIDLPDRELACAPITSPEGHE
FT                   YIGAMNAGINCALANRQILTHLTRQAFRKIIPGTKVETLYDVSHNTCKREKHVIDGRER
FT                   FVYIHRKGATRAYGPGHPDIPQRYRNIGQPVLIGGSMGTGSYILVGVDTSEQRALSTAS
FT                   HGAGRALSRRQALKQWSGKEIIQQLAARGIIVRAHSSRGVAEEAPDAYKNVDLVAEATE
FT                   YAGLANRVALLRPKICVKG"
     atggacctgt caaagctaga gaagatagat gagtatacat ggacagtgcc tcttaagcct        60
     ggggagaaaa gagctcccgt agttctgtat ggaaccaagg aactgctcag gtctatggac       120
     gacaaggtac ttgagcagat aactaacgtg gcaaagttac ccggaatagt cggcaaggct       180
     atgactatgc ccgatgcaca ctggggttac ggattcccca ttggcggagt agctgcattt       240
     gacccggaag aaggaggcat aatatctgct gggggcgttg gcttcgacat ctcttgtggt       300
     atacgctgcc tacgcacaga cctatcgttg agagatctcg agccctatgc cgagaggctg       360
     gctgatgagc tgtataaaac tattcctgct ggtgtaggag aagagggaga gatcaaactt       420
     tcccctaaag agctggacag agtgcttgaa ggcggcgctg agtgggcagt cagggaaggt       480
     tatggtgtgc cagaggattt ggagtatata gaagagcatg gacggatgga gggcgctgtc       540
     cctgagttcg tctcaaaaga agcgaagaag cgccagaaag gtgagatggg taccttgggg       600
     tcaggtaatc actatcttga agtgcaggtc gtagagaagg tttacgatca gaaagctgcg       660
     gaagcgttcg gcctatggga ggggcagata gttgtatcca tccactgcgg ctccagaggg       720
     ttaggacacc agataggaac tgattacttg ctgtcactgg ccaaggctgc tcaaagactt       780
     aagattgact taccagatag agagctggca tgtgccccta taacctctcc agaggggcat       840
     gagtacatag gggcgatgaa tgcaggtata aactgtgccc ttgcaaatcg acagatattg       900
     actcatctca cccgccaggc attcaggaag ataatacctg gtactaaggt cgagactctg       960
     tatgatgttt ctcacaacac atgtaagcgc gagaaacatg tcatagatgg gcgtgagaga      1020
     ttcgtctaca tccaccggaa gggcgcgacg cgcgcgtacg gacctggaca cccagatata      1080
     ccccaaagat accgaaatat aggccaacca gtactgatcg gcggcagtat ggggacgggg      1140
     tcttatatat tagtaggagt ggatacgagc gagcaacgcg ctctctccac ggcatcccac      1200
     ggcgcaggaa gggcgctaag tcgtaggcag gctctcaagc agtggtccgg caaggagatc      1260
     attcagcaac tggcagcgag aggcataata gtacgcgcac actcatctcg aggtgttgca      1320
     gaggaagctc ctgatgctta caaaaacgtg gatcttgtag cggaggctac ggaatatgcc      1380
     ggcttggcta acagagttgc cttattgcgc cctaagatat gcgtgaaggg ttag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page