(data stored in ACNUC7421 zone)

EMBL: CP001825.PE377

CP001825.PE377       Location/Qualifiers
FT   CDS_pept        complement(410404..411396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41301"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41301.1"
FT                   /translation="MIRRTRTLINLMKEVSLDEVREKASMPFALVITGPSRELRQKTTN
FT                   LLSGGASYTSGTLIEHDANTGWSPVFERASLVLYVLDHGQVRQSDLELLGRIARIGLPI
FT                   IVLLLNAAALVGDQNTLDRFNSMIRDSHAKIKLVRIQDSIETLLRTILQELDAFDIAIA
FT                   RQLPPFRPIVANQLISEASRANAQFALMSNIPMVIPIIGNIAAASADLLVLTKNQIMLV
FT                   FKLAAVNGQDIHSGRKILAEIIPVVGAGFFWRTVARELADLMPFGVGAIPKTIIAYAGT
FT                   FVVGRSAQYYYSTGLQPSNDLLRKFYSDALERARKLFPKQDTEPKEQTD"
     atgattcgca gaaccagaac cctgatcaat ctcatgaaag aggtcagctt agatgaggta        60
     cgggagaaag ccagcatgcc ttttgcgctg gtgataaccg gcccatcacg agagcttcgc       120
     caaaagacca caaacctttt atcaggagga gcaagctata cctctggaac cttgatagag       180
     cacgatgcaa atactggatg gtctccagta tttgagcgag catcattagt actctatgta       240
     ctggaccacg gacaggtcag acaatcggac ctagaactac tgggaaggat agctcgcata       300
     gggctaccta tcatagtatt gctcttgaat gctgcagcgc ttgttgggga tcaaaacact       360
     ttggacaggt tcaacagcat gatccgggac tctcatgcca agatcaagct agtacgtatc       420
     caggattcta tcgagaccct attgcgtaca atattgcaag agttggatgc atttgacata       480
     gctattgcaa ggcaacttcc acccttcaga ccgatagttg ccaatcagct tatatccgaa       540
     gcttcaagag ctaatgctca atttgcgctc atgtccaata tccctatggt tatacctatt       600
     atcggtaaca tcgcagcagc tagtgccgat ctgcttgtgc tcactaagaa ccaaattatg       660
     ctggtcttca agctggccgc ggtaaatggc caagacatac atagcggcag aaagattcta       720
     gcggagataa taccagtcgt cggagctggc ttcttctgga gaacagtagc cagggagctg       780
     gcagacttaa tgccttttgg tgtgggcgcc atacccaaga ctataatcgc ctacgctggc       840
     acatttgtgg ttggtagaag cgctcagtat tactactcca caggattgca gcccagcaac       900
     gacttgctca gaaagttcta ctccgacgca ctggagagag cccgaaagct gtttccaaag       960
     caagatactg agcccaagga gcaaactgat taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page