(data stored in ACNUC7421 zone)

EMBL: CP001825.PE378

CP001825.PE378       Location/Qualifiers
FT   CDS_pept        411589..411750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41302"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41302.1"
FT                   /translation="MVESPEGEIFLRTHLIEEGAHPVSNEDLDYISKAVYHQFVLPQLH
FT                   TDVSEEFH"
     atggttgaat cccctgaggg ggagatattt ttgcgtactc atcttataga agagggagct        60
     catcccgttt ctaatgaaga tctcgattat ataagcaaag ctgtctatca tcagtttgtg       120
     ttaccccagt tgcatacaga tgtgtcagaa gagtttcatt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page