(data stored in ACNUC7421 zone)

EMBL: CP001825.PE379

CP001825.PE379       Location/Qualifiers
FT   CDS_pept        411835..412092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0381"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: pin:Ping_3209 glutaredoxin
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41303"
FT                   /db_xref="GOA:D1CEE7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE7"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ACZ41303.1"
FT                   /translation="MEHSATIVVYSTSWCGDCKRAKMVLDSMNINYKLIDLELHPHAEE
FT                   EMLKVNGGIWRVPTIILPTGKVLVEPSVNELLAALEGRAA"
     atggaacatt ctgcaactat agttgtgtat agtacctctt ggtgtggcga ctgcaagagg        60
     gcaaagatgg ttctagatag tatgaatatc aactataagc ttatagatct tgagcttcat       120
     cctcatgctg aagaggagat gctaaaggta aatgggggta tttggagggt tcccacgata       180
     attctaccta ctgggaaggt attggtagag ccctctgtaa acgagctctt agctgccctg       240
     gaaggtagag ctgcatag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page