(data stored in ACNUC7421 zone)

EMBL: CP001825.PE382

CP001825.PE382       Location/Qualifiers
FT   CDS_pept        413159..413665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0384"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bcr:BCAH187_A5499
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41306"
FT                   /db_xref="GOA:D1CEF0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF0"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACZ41306.1"
FT                   /translation="MFDAALLVLRVVVGLLFIGHGAQKLFGWFGGGGLKGTAHFMESLG
FT                   LTPGRYWAVLAGLSEFVGGLLMLTGLLNPIGPLAILGAMIMATVKAHWGKPIWSSSGGA
FT                   ELPVVYGAIAVALLLTGYGRYSLDNLLNISLPSWVVLAGFLVIMLLLVLATVPGVSRSA
FT                   KYSTS"
     atgtttgatg ctgcgctcct tgtattacgg gttgtggttg gcctattgtt tattggtcat        60
     ggtgctcaga agctgttcgg ttggtttggt ggaggaggac tgaaaggaac tgcgcatttt       120
     atggaatctc tagggcttac tcctggaagg tattgggctg tgttggctgg tttgtccgag       180
     tttgttggtg ggctgttgat gcttacaggt ttgcttaatc ctattggccc acttgctatt       240
     cttggagcga tgatcatggc caccgtgaag gcccattggg gtaagcctat atggtcctct       300
     agtggtggtg cagaattgcc agttgtctac ggtgccattg ctgttgctct tcttttgact       360
     ggttatggta gatactcact agacaacctg ttgaatatct cccttcccag ttgggtagta       420
     ttggctggtt tcttggtaat aatgctcttg ctagttcttg ctaccgtccc aggagtcagc       480
     agatcggcta agtactctac gagctag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page