(data stored in ACNUC7421 zone)

EMBL: CP001825.PE383

CP001825.PE383       Location/Qualifiers
FT   CDS_pept        413866..414675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0385"
FT                   /product="serine/threonine phosphoprotein phosphatase"
FT                   /note="KEGG: xca:xccb100_3125 serine/threonine
FT                   phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41307"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF1"
FT                   /inference="similar to AA sequence:KEGG:xccb100_3125"
FT                   /protein_id="ACZ41307.1"
FT                   /translation="MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVV
FT                   SDGAGSAARGDEGSEFACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERAN
FT                   SCEAQISDYASTLLAAVVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTT
FT                   FFLTDNNSHENLLILSLDDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQ
FT                   FDGYLQELSEQLKNFLGSPRVNEYTEDDKTLLLASRVIGQQLSEVPD"
     atgacctgtt cttggaaata cgcatttgca agcgttattg gaacctatca cctgtccaga        60
     ggactccctt gtcaggatgc cataagggtt agcctatgca ggcttgaaaa agaggatgtg       120
     ctgcttgcag tggtatcaga tggagcaggt agcgctgcga ggggggatga gggatcagag       180
     tttgcctgcc aattctttgt tgagaagctg catgatttcg ttctgtcagg ttcggagata       240
     tgtaccctgg atagggagtt atgcgttggc tgggtgaaag actatctttc tcatctagag       300
     gagagagcta attcttgtga ggctcagata tcagattatg catctacgct acttgctgca       360
     gtcgttggta gcaggtcggc agtatttctt cagattggtg acggggctat agtagcttca       420
     acggaggatg atccggatag ctatactgcc atcttctggc cccagaaggg tgagtatgaa       480
     tccacgacct ttttcttgac ggacaataac tcacatgaga acctattgat cttgtctttg       540
     gatgatgtca gtatttgcga tctggcgatc ttcactgacg gcctgcagcg gatagctcta       600
     gattttaccg agaacgaagc gtataacccg ttctttcgtg gaatgttcaa tccattgaga       660
     ggccaattcg atggttatct tcaggaattg tctgaacagc tgaagaattt cctgggttct       720
     ccaagggtca atgaatatac tgaggatgat aagacactgc ttcttgcctc tagggttatt       780
     ggccagcaat tgagcgaagt tcctgattga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page