(data stored in ACNUC7421 zone)

EMBL: CP001825.PE389

CP001825.PE389       Location/Qualifiers
FT   CDS_pept        complement(418802..420883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_1852 mechanosensitive ion channel
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41313"
FT                   /db_xref="GOA:D1CEF7"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41313.1"
FT                   /translation="MIEKILLAYLAALIVIGLPGYIWSKLLFPCIDWVERIAASIAISI
FT                   GIVPAIALLLTRMSDTGITPAIAYTSVILAIAIGIALYLLLGPSPKPEMLPSLQISSPS
FT                   APALVGISALAVVAYAMIIGRLDVQKYSPRVVPLVLAIGGLWFLAKGRPAKLWWVKFEP
FT                   SYKSRALSYLQGILVILLSLFRGYSGPVLRDWPYIRGHDQYAHAIMTNLMISQGYSRDY
FT                   MIYPPGFHTLTAILSHVSHLSPLDIYIVLSPALMILPALGCYVLASRMIGPRYAFPAAV
FT                   FASLVFDSSWLYLVVGIYVDVITGQFLLAMFLATVTTIVCNKLRNLKRQALLLALLGFT
FT                   IVLYHTVSTLYLAIISLAVIVLLLPYLLWKDRRDAVALASSFLLMAILSLPVLWETYDL
FT                   PHVIAAFLGSTAKRGAAQLASSLLHTQIPLTIARLPNYLSPIGFWIGCIGLLVLLVSLV
FT                   FLPPRYRLTLALLLVWGIAFFGAARTPTSISPWRFDRDTAIPLSILSAVALVAMFGKVR
FT                   RAWIIQLAALTLIIFALFTDIQRNLYFSSLPSGYLVMNRSIEAAAEWLKEHNDGGRIIS
FT                   TPYIHHAANNALLAIAGYSELESAPADNLRDPRTVLPGEQQQEVSLSLWVVTHPDSGRT
FT                   IQILQQYDVRYIVVFEGFEKYLDEPYKETISSDIFLDYPNLYRLEYQGYGVMIFKVLA"
     gtgatcgaga agatattatt agcttatcta gctgccctaa ttgtcatagg cttaccagga        60
     tatatatgga gcaagctcct cttcccatgc atagactggg ttgagaggat agcggcctca       120
     atagccattt cgatcggaat agttccggct attgctctgt tactaaccag gatgtctgat       180
     acaggaataa ctcctgctat tgcttacact tcggtcattc ttgcaatcgc tataggtatc       240
     gcgctctact tgctgctagg accatctccc aagcccgaaa tgctcccctc actgcagatc       300
     agctccccta gtgcgcccgc actggtgggt atatctgctc ttgctgtcgt ggcctacgca       360
     atgatcatag gaaggctgga tgtgcaaaaa tactctcctc gcgtggtgcc cttggtccta       420
     gcaatcgggg gactatggtt cctggccaaa ggtagacctg caaagctgtg gtgggtcaag       480
     tttgagcctt catataagtc acgcgctctc agctacctgc aggggatatt agtaattctc       540
     ctctctctat ttagaggtta ctctggtccg gtgcttaggg actggcccta tatccgaggt       600
     cacgatcagt atgctcatgc tatcatgacc aatcttatga ttagtcaggg gtacagcaga       660
     gattatatga tctatccccc gggctttcac acccttactg ctatcctgag ccacgttagt       720
     cacctttcac cactagacat atatatcgtg ttatcacccg cacttatgat cctcccagcg       780
     cttgggtgtt atgtacttgc aagccgaatg atcggccctc gatacgcctt cccagcagcc       840
     gtatttgctt ccctggtgtt cgatagctcg tggctgtact tggtagtggg catctatgtt       900
     gatgtcataa caggccagtt cctgcttgcc atgtttctgg caacagttac aactattgtt       960
     tgtaacaagc tgcggaacct caagaggcaa gcgcttttgt tagcgctgct tggctttact      1020
     atagtgcttt accatacagt aagcactctt tatctggcta tcataagcct ggcagtaata      1080
     gttctgctgc ttccgtattt gctatggaaa gataggcggg acgccgttgc attagcttct      1140
     tccttcctgc taatggcaat cctgtctcta cctgtgctat gggaaaccta tgatcttccc      1200
     catgtaatag ctgctttctt aggatctact gccaagagag gcgcagctca actggcatct      1260
     agcctcttgc atacccaaat cccactgacc atagcgaggc tacctaacta tctatcccca      1320
     ataggctttt ggataggctg tattgggtta ctggtactac ttgtatcact tgtctttctc      1380
     cctcccaggt atcgtcttac tctcgccctg ttgttagtat gggggatagc atttttcgga      1440
     gccgccagga cacctaccag tatttccccc tggcggttcg accgagacac cgcaattcct      1500
     ttatctattt tgtcggccgt agccttggta gcgatgtttg ggaaggtacg tagagcttgg      1560
     atcatacagc tagcagcact tacactaatc atttttgccc tctttacgga tatacagcga      1620
     aatctctact tttcatcact gccatctggc tatctggtca tgaatcgtag catcgaagcg      1680
     gcagccgaat ggctaaagga gcacaacgac ggcgggcgga taataagcac cccatatata      1740
     caccacgcag ctaataacgc actattggct atagcaggtt actccgaact ggaatcagcc      1800
     cccgcagata acttacgaga cccccgaaca gtcctccctg gggagcagca acaggaggtt      1860
     agcctgtcct tatgggtggt cacccatccg gattcaggtc gaactataca gatcctgcag      1920
     cagtacgacg tcaggtacat agtagtgttc gaaggctttg aaaaatatct ggacgagcct      1980
     tataaagaaa cgataagctc ggacatattt ttggactatc caaatcttta caggctagag      2040
     taccaaggat atggcgtgat gatattcaag gttctggctt ag                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page