(data stored in ACNUC7421 zone)

EMBL: CP001825.PE39

CP001825.PE39        Location/Qualifiers
FT   CDS_pept        40192..41121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0040"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bcz:pE33L54_0031 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40963"
FT                   /db_xref="GOA:D1CDF7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF7"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACZ40963.1"
FT                   /translation="MKNLARRSEEWHLNRDWVVFLLSALFLIAIKLGLAIPWNELLPAW
FT                   AQGGAHFQIRIALAGLLVGILVGMTGMGSGALMAPLLILILKVKPSLAIGSDLVYATIT
FT                   KVFGAFQHYKHGSVHVRLTAWLAIGSVPGALLGAESVELIHRSYGDDAEHFITKVLAIT
FT                   FMLVSTSIILRTFLPIKSYSKANMENFSLTRKILTPILGFFVGFLVGLTSVGSGSLLMP
FT                   ILIMFYPMPTSTLVGTDIFHAVLLTGAAGASHFMAGNVDLILVSNLLIGSVPGIVLGSR
FT                   LVKVVPERLLRTILAIVLFLTGWKLWLN"
     atgaaaaacc tggccagacg ctcagaagag tggcatttga atagagattg ggtagtattc        60
     ctgctatcag cactcttcct gatagcaatc aagcttggtt tggcgatacc ttggaatgag       120
     ctgttgccag catgggcaca agggggtgca cactttcaaa taagaatagc ccttgcgggg       180
     cttcttgttg gcatacttgt tggcatgaca ggaatgggga gcggggctct catggctccg       240
     ctcctaatac ttatccttaa agtaaaacct tcactggcta tcggctcaga tcttgtatac       300
     gctactatca ccaaggtatt tggtgctttc cagcactata aacatggatc agtgcatgtc       360
     cgactaacgg cctggttagc tataggtagc gttccaggag cacttctagg agctgaatca       420
     gtagagctga tccatagatc ttatggagat gacgctgaac actttataac taaagtgctg       480
     gctataactt tcatgttagt tagcacatca ataatcttgc ggacatttct ccccataaaa       540
     agttactcta aagccaacat ggagaatttc tcgctaacca ggaagatctt aacacctatc       600
     ctgggattct ttgttggatt tcttgttggt ctgaccagtg taggctcagg tagtctcttg       660
     atgcccatcc tgataatgtt ctacccgatg ccaacatcta cgttagtagg aactgatata       720
     ttccacgccg tgctgttgac cggagccgct ggcgcttccc acttcatggc aggtaatgtc       780
     gatctaatac tcgtcagcaa cctgctaatt ggatcagtgc caggtatagt tctgggtagc       840
     agacttgtga aggtagtacc cgaaagacta ctacgaacca tcttggctat agtactattt       900
     ctaactggct ggaagctatg gctgaattga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page