(data stored in ACNUC7421 zone)

EMBL: CP001825.PE391

CP001825.PE391       Location/Qualifiers
FT   CDS_pept        complement(421302..422345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0393"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: scl:sce7003
FT                   NDP-sugar oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41315"
FT                   /db_xref="GOA:D1CEF9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ41315.1"
FT                   /translation="MSNEKVLITGGAGFLGINLVRHLLRKGFRVASLDIAEFDYPERNQ
FT                   VEVIKGDIRDKALLDQVMVGVDYVVHTAAALPLYSPKDIYTTDVIGTRNVLDSAYTHGV
FT                   KRVVHISSTAVYGIPDHHPIREEDRLEGVGPYGQAKIQAEMICLEYRAKGLIVPIIRPK
FT                   SFVGPERLGVFALLYDWAYTGHNFPVLGSGRNRYQLLDVEDLCDAIELCLTLPENKVND
FT                   TFNIGAKVFSTVREDYQAVLDYAGHGKKVIPIPAAPAIFILRLLEKLGISPLYKWVYET
FT                   APKDSYVSIEKAEKQLGFKPKYSNKEALIRNFQWYIDNIDKFQNKSGVSHRVPWKQGAL
FT                   SLAKLIF"
     atgagcaatg agaaagtatt gataaccggc ggagcagggt tcttagggat taaccttgtt        60
     cgtcaccttc tacgcaaagg attcagagta gcatctcttg acatcgccga attcgattac       120
     ccagagagaa atcaggtgga ggtaataaag ggagatatcc gcgacaaagc tctactcgac       180
     caagtaatgg taggcgtgga ctacgtggta cataccgcag ctgccctacc cttatactct       240
     ccgaaagata tctacactac agatgtcata ggcacaagaa acgtgctgga tagtgcttac       300
     acccatggcg taaagagggt cgtacatata tcatcgaccg cggtctatgg aatccccgat       360
     catcatccca tacgagaaga ggacaggttg gaaggtgtgg gtccatatgg ccaggccaag       420
     atacaggctg agatgatatg cctggagtac agagcaaaag gtttgatagt acctataata       480
     agacccaagt catttgtggg gccagaacgc ctgggagtct ttgcgctgct ttatgactgg       540
     gcatatacag gccataactt ccctgtgctt ggtagcggtc gcaatcgcta tcagctgctg       600
     gatgttgaag atctgtgtga tgcaatagag ctatgcttga cacttcctga aaataaggtc       660
     aacgatacat tcaacatagg tgctaaggtc ttctcaacgg taagagagga ttaccaagcg       720
     gttctcgact acgctggcca tggcaagaaa gtcatcccta tacccgcagc cccagcaatt       780
     ttcatcctta ggttgctgga aaagctaggc atatctccgc tctacaagtg ggtctacgag       840
     acagccccca aggactcata tgtctctatt gagaaggcgg agaaacagct aggtttcaaa       900
     cccaaatact ccaataaaga agctcttata agaaacttcc agtggtacat cgacaacata       960
     gacaaattcc aaaacaagag cggcgtctcg cacagggtac cttggaagca gggagcgctt      1020
     agcctagcca agctcatctt ctaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page