(data stored in ACNUC7421 zone)

EMBL: CP001825.PE392

CP001825.PE392       Location/Qualifiers
FT   CDS_pept        422446..423654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0394"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sme:SM_b20249 putative myo-inositol-1- phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41316"
FT                   /db_xref="GOA:D1CEG0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG0"
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /protein_id="ACZ41316.1"
FT                   /translation="MHALTIRSSHAYTPLYVCKNRERGNEVADKKVRVAIIGVGNCASA
FT                   FVQGVHYYKDAPEDEWVPGLMHVNLGGYHIRDIEFSAAFDVASTKVGKDLSEAIWAAPN
FT                   NTLKFADVPYLGVPVYRGMTHDGLGKYLSNMIEKAPGPTSNIVQILKDTGTDVVVNYLP
FT                   VGSEMATKWYVEQVLEAGCAFVNCIPVFIAREEYWQRRFLEKGLPIIGDDIKSQVGATI
FT                   THRVLTRLFEERGVKLERTYQLNFGGNTDFYNMLERDRLESKKISKTNAVTSQLEHSKL
FT                   DEKNVHVGPSDYVPWLEDRKWCHIRMEGTIFGGAPISLELKLEVWDSPNSAGVVIDAVR
FT                   CAKLALDRGLAGTIAGPSAYFMKSPPVQYHDDVARRMTEDFIEGKDDTCLPFKTTIDTA
FT                   EKV"
     gtgcatgcct tgacaatacg gagttcacat gcttacactc cgttgtatgt gtgtaaaaac        60
     agggaaaggg ggaatgaagt ggccgataag aaggttagag tcgcaatcat aggtgtaggt       120
     aattgtgctt ccgctttcgt gcagggagtg cattactata aggatgctcc agaggatgag       180
     tgggttcccg gcctcatgca tgtcaacctt gggggctatc acataaggga catagagttc       240
     agcgcagcct tcgatgtggc gtccacaaag gtaggtaagg acctaagcga ggctatatgg       300
     gcagcaccca acaatacgct aaagtttgct gatgtacctt acctaggtgt tccagtgtat       360
     cgaggtatga cccatgatgg tttgggcaag tacctaagca acatgataga gaaggcgcca       420
     ggccctacct ctaacatagt gcagatactg aaggacactg gtactgatgt agtagtaaac       480
     tacctgcccg taggtagcga gatggctact aagtggtatg tggagcaggt actggaggca       540
     ggttgtgcct ttgtgaactg cataccggtg ttcatcgcga gggaagaata ctggcagcgt       600
     agatttttgg agaagggact ccccataatt ggggatgata tcaagagcca ggtgggtgct       660
     actatcactc acagggtcct tacgaggctg tttgaggaaa ggggcgttaa gctagaacgc       720
     acctatcagt tgaactttgg tggtaacaca gacttctaca acatgctgga gcgggatcgc       780
     ttggagagca agaagatatc caagactaac gccgtaacca gccaacttga acatagcaag       840
     ctggatgaga agaacgtaca tgttggtcca agcgattacg ttccctggct tgaggaccgt       900
     aagtggtgcc acattcgcat ggaagggacc atctttggtg gggctcccat cagcctggag       960
     ctcaagctgg aggtttggga cagccctaac agcgctggcg tcgtaataga tgcagtgagg      1020
     tgtgcaaagc tggcgcttga tagagggttg gctggcacga tagctggccc atccgcatat      1080
     ttcatgaaga gcccgccagt acaataccat gatgatgtgg cacgccgaat gactgaggat      1140
     ttcatagagg gcaaggatga tacctgcttg cctttcaaga ccacaataga taccgctgag      1200
     aaggtttag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page