(data stored in ACNUC7421 zone)

EMBL: CP001825.PE396

CP001825.PE396       Location/Qualifiers
FT   CDS_pept        427432..428370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0398"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce5040
FT                   trehalose/maltose transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41320"
FT                   /db_xref="GOA:D1CEG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41320.1"
FT                   /translation="MAQQIRLARARQEKSSQENSALARRQARVAWLFLIPTLLVVAIVA
FT                   AWPMIQVVWLSLTNAQLLSPTPPKFIGLDNYVRLIHDSIWWHTVWNTVLFTVITVTFEF
FT                   VLGMVIALVVNSQFKARGFMRAAMLVPWAIPTVVSAMMWKWMYNDIYGVINDLLVNKLH
FT                   ILDHNVAFLAVPSLAIPSVAAIDIWKTTPFVALLLLAGLQVIPNDIYEAATVDGATAWQ
FT                   RFFQITLPLLRPAIAVTLIFRTLDALRVFDVFYVMFGNDQSRMPMAVYVQNYLVQFQDV
FT                   GYSSAISMFIFMIIGIFVVAYVTTLGVEVEQ"
     atggcacaac aaataaggtt ggccagggca agacaggaga aaagcagcca ggaaaacagc        60
     gcactagcgc gtcgacaagc ccgagtagcg tggctctttc tcatacctac ccttttagta       120
     gtagctattg tggctgcctg gccaatgatt caggttgttt ggcttagctt gaccaatgca       180
     caactgctca gcccaactcc tccaaaattt ataggtctgg ataactacgt aaggctcata       240
     catgacagca tatggtggca tacggtctgg aacactgtcc tctttacagt catcaccgtc       300
     actttcgaat ttgttttggg tatggtaata gccctcgtgg tcaattctca gttcaaggct       360
     agaggattca tgagggctgc catgctcgtg ccctgggcga tacctacagt ggtatcagca       420
     atgatgtgga aatggatgta caacgatata tacggcgtta tcaatgacct tctggttaac       480
     aaactacata tcctggatca taacgtggcc tttttggctg tacctagctt ggctattccc       540
     tccgtggccg ctatagacat ctggaagacc acgcctttcg tagctttatt gttactagcc       600
     gggctacagg ttatccccaa tgatatctac gaggccgcca ctgtggatgg tgctactgct       660
     tggcagcgct tcttccagat aactttgcct ctgcttagac ctgcaatagc ggttactctg       720
     atattccgta cgcttgatgc attgagggta ttcgatgttt tctacgtgat gtttggcaat       780
     gatcagagca ggatgcctat ggctgtatac gtccagaatt acctggttca gtttcaggat       840
     gtgggataca gctcagcgat aagtatgttc atattcatga ttattggcat attcgttgtg       900
     gcctatgtta ctacgcttgg tgtggaggtt gagcaatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page