(data stored in ACNUC7421 zone)

EMBL: CP001825.PE399

CP001825.PE399       Location/Qualifiers
FT   CDS_pept        429941..431404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0401"
FT                   /product="protein of unknown function DUF512"
FT                   /note="PFAM: protein of unknown function DUF512; KEGG:
FT                   gbm:Gbem_0981 protein of unknown function DUF512"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41323"
FT                   /db_xref="GOA:D1CEG7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG7"
FT                   /inference="protein motif:PFAM:PF04459"
FT                   /protein_id="ACZ41323.1"
FT                   /translation="MIHGGEVVRVQPNSIADDLGLQPGDVLLQINGRPLRDIIDYRFYG
FT                   AADYVELLVKRGQEYIIFEIEKDPDESLGVEFARPTFNPIRQCANACPFCFVDQNREGM
FT                   RDSLYIRDDDYRYSFLFGNFVTLTNLTPSDWRRLEEQRLSPLYVSVHTTDPDLRRRLLG
FT                   YPKAPDILEQLARLREIGIQVHTQLVLCPGLNDGPQLERTIDDLAALYPTVLSIAVVPV
FT                   GLTQFRGGSVRAGGRHNRIIASQASTPVRSYTPEEAKQVVKQVDRRRAQFRKELGTNLV
FT                   FASDEFYLMAGKSVPAAKHYEGFPQLENGIGMVRYMLEGFKESRRKLPERLKSTRKVTI
FT                   LCGTLPAKVLRQVADKMQDACSGLSVDVIPVENKFYGPSTNVSGLLVGEDLVPIIESIE
FT                   GTDLILIPRVALDNDGRRLLDGVTLQDLRDVAKYPLEPAVDMKETVDLILRMDAGEELG
FT                   KSVPPPRIGGFEFSPVPNSDTFGQYVTYS"
     gtgattcacg gcggagaagt tgtaagagta cagccaaaca gcatagcaga cgacctggga        60
     cttcagcccg gggacgtgtt gctgcagatc aatggtcgac cgctgcgaga tatcatcgat       120
     tataggttct acggtgcagc tgactatgtg gaactactgg tcaagcgagg acaagagtat       180
     atcatcttcg agattgagaa ggatcccgat gagtctttag gtgttgaatt cgcaagacca       240
     acgtttaatc ccataaggca gtgtgcaaat gcgtgccctt tttgctttgt ggatcaaaat       300
     cgtgaaggta tgagggatag tctctacata agagacgacg attataggta tagtttcctg       360
     tttggtaact tcgttacact tactaatctg actccatctg attggcggag attagaggag       420
     caaaggctta gccctctcta cgtctccgtg catacaacag atccggatct tcgtcgcagg       480
     ttgttgggct atcctaaagc tccggatatt ctggagcagc ttgcgcggtt gcgtgagatt       540
     ggcattcagg tccatacaca gctagttcta tgtcctgggc tcaatgatgg tccacagctt       600
     gagaggacca tagatgacct tgctgcgctc tatcctactg tgctctctat agctgtggtt       660
     cctgtggggc ttactcagtt tagaggagga agtgttcgag cggggggaag gcataacagg       720
     attatagcct cccaagccag cactcccgtc aggagctata caccagagga agcgaagcag       780
     gtagtaaagc aggttgatag gcgtagagcg cagtttcgta aggagctcgg cacgaatttg       840
     gtgttcgcct ctgatgagtt ctacctcatg gcagggaaga gtgttcctgc tgctaagcac       900
     tacgagggct ttccacagct cgagaacggc atagggatgg taaggtacat gctcgagggc       960
     tttaaggaat ctaggagaaa gcttcctgag cgcttgaagt caaccagaaa agtgaccata      1020
     ctttgcggaa cgcttcccgc caaggtgcta aggcaggtgg ctgacaaaat gcaagatgct      1080
     tgctcgggac tgagtgtgga tgtgatcccg gtcgaaaaca agttttacgg tcccagtact      1140
     aacgtctcag gattgctggt gggtgaggac cttgtgccga taatagaatc tattgaaggg      1200
     acggatctga tactcatccc tagggtagcc ttagataacg atgggagaag acttctggac      1260
     ggcgtaacac tgcaggacct gcgtgatgtg gccaaatatc cacttgagcc tgccgtggat      1320
     atgaaagaga cggtagatct tatattgcgg atggatgcgg gcgaggagct aggcaagtcc      1380
     gtaccaccac cacggatagg cgggtttgaa ttctccccgg tacccaattc cgatactttc      1440
     ggtcaatacg taacttactc atag                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page