(data stored in ACNUC7421 zone)

EMBL: CP001825.PE400

CP001825.PE400       Location/Qualifiers
FT   CDS_pept        complement(431500..432582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0402"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rpb:RPB_3120 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41324"
FT                   /db_xref="GOA:D1CEG8"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG8"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ41324.1"
FT                   /translation="MFTKSSKVWVLLLLFLQLVVVGCGAGNSTPTIGSTSANITPTTSS
FT                   ESNQNSQNTSSNLKQVTLALGYIPTVQFAPYYVAQEKGFYKEEGLNVKFNHGIISDLIK
FT                   MVGTGKIPYGVASGDEVLVARSQGVPVVYLGAYFQKYPVVLITRSEDHITDIKQLKGKV
FT                   IGVPGQFGATYTGLLALLHSANMNEKDVKIRSIGFTQVQALERKQVDAVMGYANNEPIQ
FT                   LRHLGVKVNTIPVWEHLNLVSNGLITSQDKLSSDPQEAAAVVRATMKGLQYTIDHPEEA
FT                   FQISLKYVPEAAQDKEIQMEVLKSSIELWQSQATKEHGLGYTDPNMWKTTLDFLKSIGL
FT                   IKHDVDLSKVYTNQFVERSR"
     atgttcacaa aatcgtctaa ggtatgggtt cttctactgt tattcttgca acttgtggtt        60
     gtcggttgtg gggcaggtaa cagcacacca accattggta gtacgtcggc taatatcacc       120
     cctactacat cctcggaaag caaccagaat tcgcaaaata cgagcagcaa cctaaagcag       180
     gtcactttag ctttgggata cataccaact gttcagttcg ccccctacta cgtagcacag       240
     gagaagggtt tctacaaaga ggaaggcctg aacgtaaaat tcaaccatgg tatcataagc       300
     gatctcataa agatggttgg cactgggaag ataccttatg gcgtcgcaag cggcgatgag       360
     gtgctcgttg ccagatctca gggggtaccc gtagtatatc ttggcgccta tttccaaaag       420
     tatcctgtag tccttataac ccgtagcgaa gatcatatca cagatataaa gcagctcaag       480
     gggaaggtaa tcggagtgcc agggcagttc ggtgccacct acacgggact acttgctctg       540
     cttcactcgg ccaacatgaa cgaaaaagac gtcaagataa ggtccatagg cttcacccag       600
     gtacaagccc tggagcgcaa gcaggtagat gcggtgatgg gttatgccaa caacgaacct       660
     atacagctaa gacaccttgg agtaaaagta aacaccatac cggtctggga gcatttgaac       720
     cttgtatcaa atggcctgat aactagccag gataagctga gctctgaccc tcaggaagca       780
     gcagcggtcg taagagcaac gatgaaagga cttcaataca ccatcgatca tccagaagaa       840
     gccttccaga taagccttaa gtatgtgcca gaggcagcac aggataaaga gatccaaatg       900
     gaagtgctca aatcctcgat agagctctgg caaagtcagg ccacaaaaga gcacggcctt       960
     gggtatacag atcctaacat gtggaaaact acactggact tcctcaagag cataggactt      1020
     atcaaacatg atgtggatct ctccaaggtt tacaccaacc agtttgtgga aagatccagg      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page