(data stored in ACNUC7421 zone)

EMBL: CP001825.PE401

CP001825.PE401       Location/Qualifiers
FT   CDS_pept        complement(432603..433418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0403"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbr:BB0643 putative
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41325"
FT                   /db_xref="GOA:D1CEG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41325.1"
FT                   /translation="MRQESYGLPAYKISTGAGELKGKLSLWGWVIASLILAILLWEAIV
FT                   LVGKYPTYILPTPMEVWQRFLQSLADGTWWTHTRITLLESILGFALGFGVAAVFGYILA
FT                   HWRAVERLLSPHIAASQALPVVAIAPLITLWFGYGLLGKVIVCALVVFFPILVNTIVGI
FT                   RNVPRDLIEVAQVYGAGWWQTFWMVELPLSLPVLLGGIRLGLTLSITGAVVGEFVGADV
FT                   GLGVLLNISKGMFDTPLMFVALITLALMAASFYGIALLLEKILLAWHYE"
     atgcgccagg agagctatgg tctaccagca tacaaaatct ctacgggtgc gggagagcta        60
     aagggcaagc tttcactatg gggctgggta atagcctcgc ttatacttgc catcctgcta       120
     tgggaagcaa tagtgctcgt aggcaagtat ccaacataca tactgcctac cccaatggag       180
     gtctggcaaa ggtttctaca gagccttgca gacggtacct ggtggaccca cacaaggatt       240
     actctcctag agagcatctt gggttttgct ctgggatttg gcgtggcagc tgtgttcgga       300
     tacatactag cccattggcg agctgtagaa cggctcctta gtcctcacat agcagctagc       360
     caggcgctcc ctgtggtagc tatagctcct ctgataactc tatggtttgg atatggactc       420
     ctaggaaaag taatagtatg cgcgctggta gtgttcttcc ccatcctagt caataccatc       480
     gtgggaatta ggaatgttcc aagagacttg atagaagtag cgcaggtata cggagcagga       540
     tggtggcaaa cattctggat ggtagaacta cctctatccc tacctgtgct acttggaggt       600
     atacgcctcg gattgacatt atccataaca ggagctgttg tgggcgagtt tgtgggggca       660
     gatgtggggc tgggagtact tctaaatatc tcaaagggca tgtttgatac ccctctgatg       720
     ttcgtagccc tcataacact agcgctgatg gcagcgtcct tttatggcat agccctatta       780
     ctagaaaaaa ttctactagc ctggcattac gagtaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page