(data stored in ACNUC7421 zone)

EMBL: CP001825.PE402

CP001825.PE402       Location/Qualifiers
FT   CDS_pept        complement(433719..434135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41326"
FT                   /db_xref="GOA:D1CEH0"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH0"
FT                   /inference="similar to AA sequence:KEGG:AT1G44920"
FT                   /protein_id="ACZ41326.1"
FT                   /translation="MSVAERERPLGRGTTYLLVAGDVLAIVLFVVLGFRSHHIQVHYLA
FT                   NLIRVATPLLAGWFIVSMFTGAYRPTAVLGEFMKRSALTWIGGILLGLLIRGLVLREGF
FT                   IFTFMLVTLAVTGVLLLGWRLVYFLIISGRSPSR"
     atgagtgttg ccgaaagaga aagaccgctg ggaaggggaa ccacatactt gctagtggct        60
     ggcgatgtac tagctattgt acttttcgta gtactcggct ttagaagcca tcacatacag       120
     gttcactatt tggcaaacct gataagggtg gcaacaccct tgcttgcagg ttggtttatc       180
     gtctcaatgt tcacgggcgc atacaggcct actgcggttc ttggagagtt catgaagaga       240
     tcggcgctaa cgtggatagg aggaatattg ctaggtctcc tgataagagg tctagttctc       300
     agagaaggct tcatctttac gttcatgttg gtcacccttg ctgtaacagg cgtgctactg       360
     cttggatggc gattggtata tttcctgatt atctctgggc gttcaccatc caggtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page