(data stored in ACNUC7421 zone)

EMBL: CP001825.PE405

CP001825.PE405       Location/Qualifiers
FT   CDS_pept        complement(436308..437066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0407"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: mpo:Mpop_4104
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41329"
FT                   /db_xref="GOA:D1CEH3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH3"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACZ41329.1"
FT                   /translation="MQDRVDRDFTREEQPLAVGDEHLSELEERIGAAPARISILLLGFV
FT                   GSLMLILLMAIIARDIFPEQSISLDRTIYLYLRNHASSFPGPLFVLGTYLGSFIVIGPL
FT                   TAAICALLFLKGYRRTPTFLVVSAVGGILVNQVFKDYVTRPRPSWPGIHQIGDYSFPSG
FT                   HAMNSVVFYIALASIIWVLFGKLYGTISFIIAIFLALFIGTSRIYFGYHYFTDVIGGYI
FT                   TGLLWVVIAATATQGGSHIIRQRRANKSKI"
     ttgcaagata gagtcgatag agacttcacg agagaggagc aacctctagc tgtaggtgat        60
     gagcatctgt ccgagctgga ggaaaggatc ggagcagccc ctgctaggat ctcaatactc       120
     ctcctaggat tcgtggggtc cttgatgctc atccttctga tggctataat cgcccgcgat       180
     atatttccgg aacaatcgat tagcttagat cgaacaatat acttatatct caggaaccat       240
     gcatcaagtt tccccggccc actgtttgtt ttagggacct accttggatc gtttatagta       300
     attggtccgt taacagctgc gatctgtgct ctacttttcc taaagggata taggagaact       360
     ccaacattcc ttgtggtgtc tgcagttgga ggcatattag taaaccaggt ctttaaggac       420
     tacgtaacac gccctcggcc cagctggcca ggtatccatc aaataggaga ctatagtttc       480
     ccaagcggac atgctatgaa ctctgtggtg ttctatatag cgctcgccag catcatctgg       540
     gtgctattcg gtaagctgta cggcacgata agctttataa tagctatctt cctggcattg       600
     ttcataggaa ctagcaggat atatttcggc taccattact tcacggacgt aatcggtggt       660
     tacataaccg gcctgttatg ggtagtaatc gcggctaccg ccactcaagg cggtagccac       720
     ataataagac aaagaagggc aaacaaatct aaaatctag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page