(data stored in ACNUC7421 zone)

EMBL: CP001825.PE407

CP001825.PE407       Location/Qualifiers
FT   CDS_pept        437657..439075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0409"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ppd:Ppro_3253 FAD linked oxidase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41331"
FT                   /db_xref="GOA:D1CEH5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH5"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACZ41331.1"
FT                   /translation="MKESVIEELRSILGPSGLLVDQGDLLAYSIDGTWLEAMPDCVVLP
FT                   TSTQQVAQVMSIANRELVPVVPRGGSSNLSGGTIPINGGIVMSLTRMNKILEIDPDNLI
FT                   AVVQPGVITHDLQSEVRKYGLYYPPDPSSVQHSTIGGNVAENAGGLRCLKYGVTSKYVL
FT                   GMEYVTPTGEVGRAGGRVIKNVTGYQLEQLLIGSEGTLAIITEITLRLIPYPKYRRTLM
FT                   AVFDRLEDAGKAVSEITRAGIIPAAMELMDKSCIQVVEDYLRIGLPVAAEAMLLVESDG
FT                   YYESAVEAEIRHIDGILSELAAEVNLAEDESQAEELWRARRSVSPAVAKIKPNKLGEDV
FT                   CVPRSAVPEMIRRCQEIAEKYDLKLVIYGHAGDGNIHPNILFDKRDVDEVSRVQKAAAE
FT                   IFQAAVELGGTLTGEHGIGLLKKGFLGLALDSTTIGVMRTIKRALDPNNILNPGKIFPD
FT                   EASYLQVPFDVGRT"
     atgaaggaga gcgtgatcga ggaattaagg tcgatacttg gtccttcagg actgcttgtg        60
     gatcaagggg atctgttagc ctactctata gatggcacct ggttagaagc tatgccagac       120
     tgtgtggttt tgcccacatc tacacaacag gttgcccagg tgatgtctat agccaataga       180
     gagctcgttc cagtagtgcc tcgtggaggc tcttctaatc tctctggcgg caccatcccc       240
     attaatgggg gcatagttat gagtctcacc aggatgaaca agatactcga gatagatccg       300
     gacaacctga tcgccgtagt gcaaccggga gtaataactc atgatctgca gagcgaagtc       360
     cgcaaatatg gtctttacta tccgcccgat ccctctagtg tgcagcatag tactataggg       420
     gggaacgtgg cagagaatgc tggtggatta aggtgtctga agtatggtgt aaccagcaag       480
     tacgtattgg gtatggagta tgtaactcct acaggcgagg taggcagggc tggtggaaga       540
     gtaatcaaga acgtgacagg gtatcagctt gagcagttgc ttattggcag tgaaggaacg       600
     ctagctatca ttaccgagat aacgcttagg ttgattcctt atccaaaata taggcgtact       660
     ctgatggcgg tattcgacag gctagaagat gctggtaagg ctgtgtcaga gattacacga       720
     gcagggataa taccggccgc tatggagctg atggacaagt cctgtatcca ggtggtagag       780
     gattacctgc gtataggact gccggttgca gcggaggcga tgctgcttgt ggagtcagat       840
     ggatactatg agtcagcggt agaagctgag ataaggcata tagatgggat attatcggaa       900
     ctagctgctg aggtgaattt ggccgaggat gaatcgcaag ctgaggagct gtggcgagct       960
     agaagatccg ttagtcccgc tgtagctaag ataaagccca acaaacttgg cgaggatgtg      1020
     tgtgtccccc gtagcgctgt cccggagatg atacgcaggt gccaagagat agctgagaag      1080
     tacgatctga agctggttat ctatggtcac gctggggatg ggaacattca tcccaacata      1140
     ctctttgata agcgggacgt tgatgaggtg agtagggtac agaaagcagc tgcagagatt      1200
     tttcaagcag ctgtggagtt gggtggtacg ctcacagggg agcatggaat tgggctgctc      1260
     aagaagggtt ttcttgggtt ggctctcgac agtactacta taggagtgat gcggaccatt      1320
     aagcgggcgc tcgacccaaa caatatactc aatcctggca agatatttcc tgatgaggcg      1380
     tcgtacctgc aggtaccttt tgatgtgggt aggacttaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page