(data stored in ACNUC7421 zone)

EMBL: CP001825.PE408

CP001825.PE408       Location/Qualifiers
FT   CDS_pept        439099..440250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0410"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   sat:SYN_02526 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41332"
FT                   /db_xref="GOA:D1CEH6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH6"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ACZ41332.1"
FT                   /translation="MANVEESRDQDYISVDHMALKSWVTEVFCKLGVPREDADVTADVL
FT                   VAADLRGIESHGVARLGRYTSRLMKGLISPVANPVIVRETSSTALVDGNNGLGQPVAMW
FT                   AMQLAIDKAREVGSGTVAVRNSNHYGIAGYYAMMALEHDMIGMSLTNSSPLVVPTGGRK
FT                   AVIGTNPIAVAIPAGKERPWVLDMATSVVPRGKLEVYARKNKPMPLGWAVDETGQPTTD
FT                   AQRVLDALTARLGGGILPLGGTALFSGYKGYNLSVMVDLLCGVLPGSNWGPKVDEPVDG
FT                   KLVPSRVGHFFWALRVDAFRPIDEFKQEMDDYIRMLKESPKAEGEDRIWVAGEKEWELQ
FT                   EEYSREGVPLYYKVVETLRGIGQEVGLPFDAMVLGAGHSTGMA"
     atggctaacg tggaggagtc tcgggatcag gattatataa gcgtagatca tatggcgctc        60
     aaatcctggg taacagaagt cttctgtaag ctgggcgtgc ctagggagga cgctgatgtt       120
     actgcagatg tgctggttgc agctgatctt agaggcatag agagtcatgg ggtggctcgt       180
     cttggccgct acactagcag attgatgaag gggcttatct ctccggtagc aaaccctgtg       240
     atagttaggg aaacatcatc taccgctctt gtagacggta acaatggact agggcaaccc       300
     gtggctatgt gggctatgca gctggctata gataaagcca gggaagttgg gagcggtaca       360
     gttgctgtaa ggaacagtaa ccactatggc atagcgggct attatgcgat gatggcgcta       420
     gagcatgaca tgatagggat gagcctgact aattcaagtc cgctggtggt acctactggt       480
     ggtagaaaag ctgtgatagg gaccaatccg attgctgtgg ctattcctgc gggtaaagag       540
     aggccatggg tgctcgatat ggcgacaagt gtggtcccga ggggtaagct tgaggtgtac       600
     gcaaggaaga acaagcccat gccccttggt tgggctgtgg atgaaaccgg tcagcctacg       660
     acagacgctc agagggttct ggatgctcta actgcccgct tgggaggggg tatcttacct       720
     ttaggaggta cagctctgtt tagtggttat aaaggctata acctatctgt aatggtagat       780
     ctgctatgcg gggtgctgcc cggttcaaat tggggtccca aagtagatga gcctgtagat       840
     ggcaagctag taccatccag ggtgggacac ttcttctggg cgttgagggt agatgccttc       900
     aggcccattg acgagttcaa gcaagagatg gatgattaca tcagaatgct caaggaatcc       960
     cccaaggctg agggggaaga taggatatgg gtagcaggtg agaaagagtg ggagcttcaa      1020
     gaggaatatt ctcgtgaagg agttcccctc tattacaaag tcgtcgagac cctgcggggc      1080
     atagggcaag aggtggggct cccatttgat gctatggtgt taggggcggg gcatagtaca      1140
     ggcatggcat aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page