(data stored in ACNUC7421 zone)

EMBL: CP001825.PE41

CP001825.PE41        Location/Qualifiers
FT   CDS_pept        complement(42389..44989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0042"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mca:MCA1018 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40965"
FT                   /db_xref="GOA:D1CDF9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF9"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACZ40965.1"
FT                   /translation="METGQVRTLPSAFGLAKLSWNRNRLLLAGMLAFILLLLAASGIYA
FT                   IAYSGKIYPGVKVLGVDLSGKTKQEAARLLQSRADKLLESPVVLTADKHRFQVKSSDLG
FT                   VRFDIQAMVDSAYQFGRSDAFASRWLQRFMAPFSDHEVAPVVSLNNAKTRDTLESIAST
FT                   VDRPVRNAKIILGEDGPRFITSQVGVKLDIDSNLKSLSNSIPRAYEKSTTVSLKVIYTR
FT                   PSIEDSDLQPIYKGLVAAWNRPLTLKFGDKQWAMPVSEVRQLLRLDTSGKLPKPYLLEA
FT                   PIRNWLEDISQEIDSDPVDARIKVLSQSVELVPHKDGYTLLEDQTVERIQTEAFKSGII
FT                   DVVVQVTHPNLTTESLKPVVDKANAMVNQPFEVSYRNRSWTLEPQDLVQMLRWNKDDTP
FT                   PTPYISRNKLRTWLSGVAERIERSPVNARVIVDNGKVRIIPARIGVRLDIDANLKALIS
FT                   AISSGNTRQFALQVQRWEPKIRSSDLRPAVDLANQLISDPITVSYSSGNWNIDSTTLAS
FT                   WLRWEGNGKDITPVLDYDSVRSFVYQIAQQVNKDPSDAYLSVAGGYAHIVPETVGVTVD
FT                   IESTTQKIINAASTSTRNVTLDVTTSYPQVTSDDLKPALDKMLYWTGERFYMSLNGRTW
FT                   WLDPSDLVLALRWYGTGENTVVYLDENALEQQIRRWVPQDSVTDMDINYSATAQVAMKA
FT                   IVNGNRHIAIVAEPIKNDTSDQEHKGYESFWKGDFPDKWIDINLSSQSLAAYEGSKQVK
FT                   VSLITSGRPELPTPTGLFHVLSKISPKVFISPWPKDSEWYYPPSKANFALLFRSGGYYI
FT                   HDAPWRSVYGPGTNGSGPPGDARTGSHGCVNVPYSMMAWLYSWAEVGTPVLIHY"
     atggaaactg gtcaggtaag aactctgccc tctgccttcg gactagctaa gttgtcctgg        60
     aatcgtaaca ggttgttact agctggaatg ctagcattta tactgctctt gctagctgct       120
     tcaggtatat atgctattgc ttattctggc aagatttacc caggggtaaa agtccttggg       180
     gttgatctct ctggaaagac taagcaggaa gctgcaagat tactacaatc tagggcagat       240
     aaactcttag agtcgccagt agttctcact gctgacaaac atagattcca ggtaaagtct       300
     tcagatctcg gagtcagatt tgatatccag gcaatggttg actcagccta ccagtttggc       360
     cgttcggatg cctttgcctc aaggtggctc cagcgtttca tggcaccttt tagtgatcat       420
     gaggtagctc ctgttgtatc ccttaataat gccaagacca gagatactct ggaatctata       480
     gcttctactg ttgatcgccc agttaggaat gccaaaatca tactgggcga ggatggtccc       540
     aggtttatta cttcacaagt gggagtcaag ttagatatag actccaacct caagagtctc       600
     tctaattcca tcccgagagc atacgaaaag agcacaactg tatcacttaa ggtcatatac       660
     acacgtcctt ctattgagga cagcgattta caaccaatct ataaaggatt ggtagccgct       720
     tggaacagac ctctaactct gaagtttggt gataagcaat gggctatgcc ggtatctgag       780
     gttaggcagc tgctgcggtt ggatacttca ggtaagttgc ctaagccata tctacttgaa       840
     gctccaatta ggaactggct ggaggatatt agccaggaga tagattctga tcctgttgat       900
     gccaggataa aagtactgtc gcagtctgta gagttagtgc ctcataaaga tggttatacg       960
     cttcttgagg atcaaactgt agagcgcata cagacagagg catttaagag tggcattata      1020
     gatgtggttg tgcaggttac ccaccctaat ctcactaccg aaagtcttaa gcctgtagtt      1080
     gataaagcca atgctatggt caaccaaccc ttcgaggtat cctatcgtaa tcgtagttgg      1140
     accctcgaac ctcaggacct agttcagatg ctaaggtgga ataaagacga tactccgcct      1200
     acaccctata tatctaggaa taagttgcgt acatggttat ctggggttgc tgagcgcata      1260
     gagcgttctc ctgtaaacgc tagagtaatc gttgataacg gcaaggtaag aataattcca      1320
     gcaaggatag gcgtcaggct agacatagat gccaacttga aggctctgat atctgctatt      1380
     agctctggta acaccaggca atttgctctt caggtgcaaa gatgggagcc taaaatcagg      1440
     agctcagatc taagacctgc cgttgatctt gccaaccagc ttatatctga tcctataacg      1500
     gttagctact ctagtggaaa ctggaacata gattcaacaa cgcttgcaag ctggcttcgt      1560
     tgggaaggta atgggaagga tataacgcct gttctcgatt atgacagtgt gagaagcttt      1620
     gtttaccaga tagcccagca agttaataag gatccttctg acgcttatct cagtgtagct      1680
     ggcggttatg cccatatagt gcccgagacg gttggggtca ctgtcgatat agaatccacc      1740
     acgcaaaaga taatcaatgc tgcttccacc tctactagga atgttaccct ggatgtaaca      1800
     acgtcttatc ctcaggtaac atcggatgat ctaaaacccg ccttggataa gatgctctac      1860
     tggactgggg aaagattcta catgtccttg aatggtagaa cttggtggct ggatccaagc      1920
     gatttggtgc tggccctgag atggtacgga actggtgaaa atactgtggt ctacctggac      1980
     gagaatgctc tggagcagca gataaggcga tgggtgcctc aggattctgt aacggacatg      2040
     gacataaatt attcagctac cgctcaggta gctatgaagg caatcgtcaa tggtaatagg      2100
     cacattgcta tagtggcaga accaatcaag aacgatacat cagatcagga acacaaaggt      2160
     tatgagtcat tctggaaagg ggatttcccc gacaagtgga tagatataaa tctttcctct      2220
     caaagtttgg ctgcatatga gggatcaaag caggtcaagg tatccctgat taccagtggt      2280
     agacccgaac tgcctacgcc cactggttta ttccatgtgc tatcaaagat tagtcctaaa      2340
     gttttcatat ccccatggcc taaggattcc gaatggtact atccaccttc caaggctaac      2400
     tttgcactgc tgtttagatc tggaggctac tacatacacg atgcaccatg gaggagcgtt      2460
     tatggaccag gaactaacgg atccgggcct ccaggcgatg cacgtaccgg gtctcatgga      2520
     tgtgttaacg taccttatag catgatggcc tggttgtatt cctgggcaga agtgggtacg      2580
     ccggtcctga tacactatta g                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page