(data stored in ACNUC7421 zone)

EMBL: CP001825.PE410

CP001825.PE410       Location/Qualifiers
FT   CDS_pept        complement(441864..442601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0412"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   dvu:DVU2313 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41334"
FT                   /db_xref="GOA:D1CEH8"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH8"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ACZ41334.1"
FT                   /translation="MAGKLSIVENSSEVARAGAEQFISRAKESIDDHGSFFVALSGGST
FT                   PVAMYKLLASDEYRGKVDWDKVLFFWSDERCVPPDHPDSNYGSAHQHLLQPLGITEDRV
FT                   FRMKGELPPEEAAREYEEIVKKAVPGDPPRFDLIFLGLGDDAHTASLFPETDALHVTDR
FT                   LVVHNYVPKLNTYRITFTSTLINAAASVVFLVSGEGKAEALKSVLEGEQNPTKYPAQMV
FT                   NPTSGALLWVVDRAAASLLSGTQ"
     atggcaggaa agttatcgat tgtagaaaat tcctccgagg tagctcgagc tggagctgag        60
     cagttcatat ccagagctaa agaatcaata gatgaccatg gttcgttctt cgtggcgcta       120
     tcaggtggat caacgcctgt ggcaatgtac aagttgctag cttcggatga atacagaggc       180
     aaagtcgact gggacaaagt gctcttcttc tggagcgacg agaggtgtgt gcctccagat       240
     cacccggata gtaactacgg atcagcacat cagcatctcc tgcagccact cggtataacc       300
     gaagacaggg tcttcagaat gaagggcgaa ctcccacccg aagaagctgc aagagaatac       360
     gaggagattg taaagaaggc tgtacctggc gatcctccaa gattcgacct gatatttcta       420
     ggattgggag atgatgcgca tacagcctca ttattccctg aaaccgacgc tctgcatgtc       480
     accgatagat tagtggtaca taactacgta cccaagctga atacctacag gatcactttt       540
     acttctaccc ttatcaatgc ggcagccagt gtggtctttc tggtatctgg ggagggcaag       600
     gcagaagcgc tcaagtcggt cttggagggc gagcaaaatc cgactaagta ccctgctcag       660
     atggtaaatc caaccagtgg cgcgctgctg tgggtcgtag atcgggcagc agccagtctg       720
     ctctcaggca cacagtag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page