(data stored in ACNUC7421 zone)

EMBL: CP001825.PE412

CP001825.PE412       Location/Qualifiers
FT   CDS_pept        complement(447127..449001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0415"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: scl:sce8467 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41336"
FT                   /db_xref="GOA:D1CEI0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI0"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41336.1"
FT                   /translation="MAVTTDQKTQIEQWHELAQQLRVDSLRCSTEAGSGHPTSSMSAAD
FT                   LMAVLMSKYLRYDFNNPENPGNDHLIFSKGHASPLLYSMFKAAGAITDEELMTFRKFGS
FT                   RLQGHPTPAIPWVDVATGSLGQGLPIAIGIALSGKYLEKLPYRVWVLCGDSEMAEGSMW
FT                   EAFQHAGYYKLDNLIAIVDVNRLGQRGETMLGWNLDGYAERAKAFGWHVIEIDGHNLEE
FT                   IDRAYEEAIQVTGQPTVILARTHKGRGVSFLEDKEGWHGKPIDKDSLPKAIEELGGERN
FT                   ITIEVPKPDPVEAPSRGENKPLELPKYEVGDSVATRGAYGDALKALGAARGDVVALDGE
FT                   VSNSTYSERFAKAYPDRFFEMYIAEQQMVAAAIGLGVRKWVPFASTFAAFLTRAYDFIR
FT                   MGAISRANIRLCGSHAGVSIGEDGPSQMGLEDIAMMRAVHGSTVLYPCDANQTAQLVAA
FT                   MADQNGISFLRTTREKTPVIYSSDEEFKIGGSKVVKQSSNDVATVVAAGITVHEAIKAY
FT                   EELQKEGVSIRIVDAYSVKPIDVATLIESLQATGGKLVIAEDHWPEGGLGEAVLSALAD
FT                   SGQVSLSDIKVKHLAVRDMPGSGKPQELLDAAGISAKHIANAVRELSK"
     atggctgtaa caaccgacca gaagacccag atcgagcagt ggcacgaact agcccaacag        60
     ttgagggttg atagccttag gtgcagcact gaggcagggt ccggtcatcc cacctcttcc       120
     atgtctgctg cggaccttat ggcagtcctg atgagcaaat atctgcgata tgacttcaat       180
     aatccagaga atcctggaaa cgatcacctt atcttctcaa aggggcatgc ctctcccctg       240
     ctgtattcca tgttcaaggc agcgggagcc atcaccgatg aggagttgat gaccttcaga       300
     aaatttggta gccggctcca gggacacccc acacccgcta taccatgggt ggatgttgcc       360
     accgggtccc ttgggcaggg acttcccata gccataggca tagcactctc tggcaagtac       420
     cttgagaaac ttccctacag agtctgggta ctctgtggcg atagcgaaat ggctgaaggc       480
     tcaatgtggg aggccttcca acacgcaggg tactacaagc tcgacaactt gatagcaata       540
     gtagacgtca acaggcttgg ccagcgcggc gagacgatgc tcggatggaa cctggacggc       600
     tacgcggagc gcgctaaggc ctttggatgg cacgtcatag agatagatgg tcataacctt       660
     gaggagatag atcgagcata cgaggaggcc atacaggtca caggccaacc taccgttata       720
     ctcgcacgca cccataaggg cagaggcgta agcttccttg aggataagga aggctggcat       780
     ggcaagccca tagataagga tagcctcccc aaggcgattg aggaactggg cggtgaaaga       840
     aacatcacca tagaggttcc taagccagat ccggtagaag ctccaagcag aggggagaac       900
     aagcccttgg agcttccgaa gtacgaggtg ggagattccg tagccaccag aggtgcctat       960
     ggtgatgccc tcaaggcgct gggcgcagcc agaggagatg tggtggctct cgatggagag      1020
     gtaagcaact ccacttattc tgaaagattc gccaaggcct atccagacag attctttgag      1080
     atgtacatag cggagcaaca gatggttgcc gcagccatag gccttggagt gcgcaagtgg      1140
     gtgcccttcg catccacgtt cgccgcgttc ctgacaagag cttatgattt tatacgaatg      1200
     ggtgctatat ccagggctaa catccggctc tgtgggtccc atgcgggcgt atccatcgga      1260
     gaggatggtc cttcgcagat gggtctggaa gacatagcga tgatgcgtgc ggtgcatggc      1320
     agcacggtgc tgtatccttg tgatgccaat cagaccgccc agctggtagc tgcgatggca      1380
     gaccagaacg gcatcagctt cctgcgaaca accagagaga agacacccgt catttattcc      1440
     tctgacgagg aattcaagat aggcggcagt aaggtcgtca agcagtcaag taacgacgtc      1500
     gccacagtcg ttgccgccgg cataacggta cacgaggcga ttaaggccta cgaggagcta      1560
     caaaaagagg gggtgtctat caggatagta gatgcttact ctgtcaagcc gatcgatgtg      1620
     gcgactctga tcgaatccct gcaggccaca ggtggcaagc tggtgatcgc agaggatcac      1680
     tggccagaag gaggcttggg cgaggcagta ctctctgctc tggccgattc agggcaagta      1740
     tcgctttctg atatcaaggt caagcacctg gcggtccgcg atatgcctgg ctctggtaag      1800
     ccgcaggagc tgttggacgc agcaggtatc agcgccaagc acatagccaa cgcagtacgt      1860
     gagctatcca aatag                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page