(data stored in ACNUC7421 zone)

EMBL: CP001825.PE413

CP001825.PE413       Location/Qualifiers
FT   CDS_pept        complement(449118..450512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0416"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bat:BAS3177
FT                   gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41337"
FT                   /db_xref="GOA:D1CEI1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI1"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACZ41337.1"
FT                   /translation="MSHKPSEPCVLSIDIGTSSIRSCLIDATGDIADNTLFAIEHSPTT
FT                   TPDGGSELDPEEAFTKVCAVIDKSLSAAREYSVLPAAVAMTSFWHSLMGIDHRGKAITP
FT                   VYLWADTRSAPYVDQLRSEASVDETYKRNGCPLHSSYWPSKLLWLRDSRPELYSQVDKW
FT                   LSFAEYVQLRFTGELRCAHGMASGTGIYLQREMSWDPFWIDLLDLRENSLPRLTSLREP
FT                   LGYLRVSDFPWKDLAGIPWYPAVGDGACSNIGSGAFDSSKVAINFGTSGAIRIVVDQYL
FT                   EPPYGLWLYRIDKDRLLFGGALSNAGNIYEWLTETLRISHEQAEQCLLTIQKVKPGLVF
FT                   EPYLAGERSPRWRPDATGTIRGLRLDTKPEDIFKAGMLGVLYEFAKVHDMLDNSLGSDD
FT                   RVTLLSGGAIIKSQALRKALSEVLRRPTMICLEEEPSARGAALLVLEAIGAVKELKDAP
FT                   TRLVAP"
     atgtcccata aaccgtcaga gccttgtgtc ctaagcatag atataggaac ttcatctata        60
     cgctcatgcc tgatagatgc tactggcgat atagccgata atacactgtt tgccatcgag       120
     cactcaccaa caaccacccc ggatggggga tctgagctag atcccgaaga ggctttcact       180
     aaagtctgtg ctgtcataga taaatcgcta tcagctgctc gggagtacag cgtactgcca       240
     gctgcagtag cgatgacatc tttctggcat agcctcatgg gcatagacca cagaggaaag       300
     gctatcaccc cagtttacct gtgggcagat acacgctcag caccatatgt agatcagcta       360
     agatctgaag cgagcgtaga cgagacatac aaaaggaatg gctgtccgct tcattcctcc       420
     tactggccgt caaagctgct ctggctaaga gactcgcggc ctgagctgta ctctcaagta       480
     gacaagtggc tgtcatttgc cgaatacgta cagctgaggt tcacagggga gttaagatgt       540
     gcccatggca tggcatcagg tacgggcatc tacctacagc gtgagatgtc atgggatccc       600
     ttctggatcg acctcctcga tctgagagaa aattctctcc cgagactcac ttctctgaga       660
     gaacccttgg ggtacctgcg cgtctcagat tttccatgga aggatcttgc tggtatccca       720
     tggtaccctg cagtaggaga tggagcctgc tccaatatag gtagcggtgc cttcgatagc       780
     agcaaagtcg ctataaattt tggcactagc ggagccattc gaatcgtggt tgatcagtac       840
     ttagaaccac cctatggtct atggttgtac aggatagata aggacaggtt gctatttgga       900
     ggtgccctga gtaacgcggg caatatatat gaatggttaa ctgagacact gcgcatctcg       960
     cacgagcaag ccgagcaatg cctgctgacc attcagaagg tcaaaccagg cctggtattc      1020
     gaaccttatc tagctgggga aagaagtccc aggtggcgac ctgatgctac tggcaccatc      1080
     agaggattga ggctggacac aaaacccgag gatatattca aagccggcat gctgggcgtg      1140
     ctttatgagt tcgccaaggt acacgatatg ctggataact cattaggcag tgacgataga      1200
     gtcacactct taagcggtgg tgcaatcata aaatctcagg ctttgagaaa ggctctcagc      1260
     gaagtcttga gacgcccaac gatgatttgt ctggaagaag aaccttcagc gagaggagct      1320
     gctctactag ttctggaagc tataggagcg gtcaaggagt taaaagacgc tcctacaagg      1380
     ctagtagctc catag                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page