(data stored in ACNUC7421 zone)

EMBL: CP001825.PE414

CP001825.PE414       Location/Qualifiers
FT   CDS_pept        450594..451103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0417"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: dvm:DvMF_0460
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41338"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI2"
FT                   /inference="protein motif:PFAM:PF01928"
FT                   /protein_id="ACZ41338.1"
FT                   /translation="MRETEIKLRVENLEEVEERLRRVGAMPREERVEEVDRIFRDVTGD
FT                   RLESQLLRLRTSAGKNTLTWKGEPKFRGGVKEREEEQTGVESAEAMIEILRRLGFEVDL
FT                   EFSKVRNYWELEGCMVSLDTLPFGRFIEIEGDEAAIVRVRRILELEAAEEVKLSYPEMA
FT                   RIHLGK"
     atgagggaaa ctgagataaa gcttagggtt gagaacctgg aagaagttga agagagactc        60
     agaagggtag gagctatgcc cagggaagag cgcgtagaag aggttgacag gatcttccgg       120
     gatgttaccg gcgatcgtct tgagagtcag cttttgcgcc tgcgtacctc tgcaggcaaa       180
     aacacactca catggaaggg tgagcccaag tttagaggag gggtgaagga gagggaagaa       240
     gaacagacag gagtagaatc agcggaggct atgatcgaga tattaagacg cctgggcttc       300
     gaagtcgatc ttgagttttc caaagtgcgc aactactggg agctagaagg gtgtatggtg       360
     agcctggaca cgctaccgtt tggcagattt attgagatag aaggcgatga ggctgcgata       420
     gtgcgagtga ggcgaatact ggaattagaa gctgctgagg aggtaaagct gagctatcct       480
     gagatggcca gaatacatct cgggaaatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page