(data stored in ACNUC7421 zone)

EMBL: CP001825.PE415

CP001825.PE415       Location/Qualifiers
FT   CDS_pept        451422..453290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0418"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: sde:Sde_2028 oligopeptide ABC transporter periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41339"
FT                   /db_xref="GOA:D1CEI3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ41339.1"
FT                   /translation="MDSHKRSFKMLLATGVMSLFLAACGGGGGGQTPTPSTASPSPSPA
FT                   ASPTPVASPVASPTPAASATPAVSQTPTVSETPTTGGQTSGGQAYKLGPALMGGGAENP
FT                   DADPNATLTIDYAKGAQTFDPQVESFVNEIQVSSQVFAPLLALDKDNNLVANAAESMTV
FT                   SPDGKTYTFKIRSGMTYSDGKPVTAENYAYAIKRACDPNVNGKYSSILYAIQGCQAWRE
FT                   ADLEKDKAKLPQLKAVVDKAVTATDDQTLVIKLTQPAGYFPYVMATWVTYPSRQDLVEA
FT                   GGTNWWKDPKYFIGNGPFKMVSYNPQQGVVFERNDNYFRGKPGVAKLVFKVINDPQVGF
FT                   LAYQRGELDAVGISSDQLPQIKGDLQKQLVRQVDAATFYIGFNLEKKPFDNQKVRQAIA
FT                   YALNREQYIRQINGGVGKPAGTFIPPGIPGHQDEVQQTYDPEKARQLLAEAGYPNGRGF
FT                   PPQKLYYDAEDSAAKKRAIFIQQNLKQVLNIDIVATPLESTTLQSMLNDRSKNPPIYRL
FT                   GWIQDYPHPQDWDSLVFGNNSPLAPNGWNDPEFNALVNKADKLPIDQAIPLYQQAEKIL
FT                   VEKAPVAFQFHSESLVLIKPNVKGVSHHLSDPLGLIYESDKIYKTK"
     atggacagcc acaagcgctc tttcaagatg ctgcttgcta caggtgttat gagcctgttc        60
     ctggctgcct gcggtggcgg tggaggcggg cagactccta ccccaagtac tgccagcccg       120
     tcgccctcac cggcagctag tccaacgcct gtagcttcgc ctgtagccag tccgacaccg       180
     gcagcgtccg ctacgccggc cgtgtctcag actccgactg tttcggagac acctactacc       240
     ggtggacaga cctctggcgg gcaggcttat aagctcgggc ccgcccttat gggtggtgga       300
     gctgagaatc cagacgcaga tcccaacgcc actctgacta tagactatgc caaaggggct       360
     cagaccttcg acccacaggt tgagtccttc gtcaatgaga tccaggtaag ctctcaggtg       420
     tttgcacctc tcctggctct cgacaaggat aacaacctgg tggcaaatgc tgcggagagc       480
     atgaccgttt ctcctgatgg caagacctac acgttcaaga ttcgttcggg catgacctat       540
     tccgatggca agcctgtaac tgctgagaac tatgcttatg ccatcaagag ggcatgcgac       600
     cccaatgtaa acggtaagta ctcttcgatc ctgtacgcca tacagggctg ccaggcctgg       660
     cgcgaggcag atctggagaa ggacaaggct aagctgccac aactcaaggc cgtagtagac       720
     aaggctgtga ccgcgactga tgaccagacc ctggttatca agctgacaca gcccgctggt       780
     tacttcccgt acgtgatggc tacatgggtt acctatccat cccgccagga tctggtagag       840
     gccggtggta ctaactggtg gaaggatccc aagtacttca tcggtaatgg cccattcaag       900
     atggtcagct acaacccaca gcagggtgta gtgttcgagc gcaacgacaa ctacttccgt       960
     ggtaagccgg gcgttgccaa gctcgtcttc aaggtcatca acgatcctca ggttggtttc      1020
     ctggcttacc agaggggtga gctggatgca gtaggtatct cttctgacca gctacctcag      1080
     atcaagggtg atctccagaa gcagttggta aggcaggttg atgcagcgac cttctacatc      1140
     ggcttcaact tggagaagaa gccatttgat aaccagaagg ttcgccaggc tatagcctat      1200
     gctctcaacc gcgagcagta catacgacag atcaacggtg gtgtaggtaa gcccgctggc      1260
     accttcatcc cgcctggaat tccaggtcac caggatgagg ttcagcagac ctatgatcct      1320
     gagaaggcca ggcagctgct tgccgaggct ggttatccca atggtagagg attcccaccg      1380
     cagaagctgt actacgatgc tgaggacagt gctgccaaga agagagctat cttcatacag      1440
     cagaacctga agcaggtcct caacatagac atcgtagcta ctccgttgga gtccacgacc      1500
     ctgcaatcta tgctgaacga caggtccaag aacccaccaa tctatagatt gggatggatt      1560
     caggactatc cacacccaca ggactgggat tccctggtgt ttggcaacaa cagcccgctg      1620
     gctcctaacg gttggaacga tccagagttc aacgctctgg tgaacaaggc tgacaaactg      1680
     ccaatcgatc aggctatacc tctgtatcag caagcggaga agatcctggt tgaaaaggct      1740
     ccagtcgctt tccagttcca ctccgagtcg ctggtgctga tcaagccaaa tgtcaagggt      1800
     gtgtcccatc acctgagcga tcctcttggc ctgatctacg agtctgacaa gatctacaag      1860
     accaagtag                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page