(data stored in ACNUC7421 zone)

EMBL: CP001825.PE416

CP001825.PE416       Location/Qualifiers
FT   CDS_pept        453431..454354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0419"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU11440 oligopeptide
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41340"
FT                   /db_xref="GOA:D1CEI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41340.1"
FT                   /translation="MLRFIVNRLLWMIPVLWLVGTVTFFLMHAAPGSPWDVRVGGKNIS
FT                   PELEKSFNRKYGLDKPLVVQYLIYWRNVLKLDFGQSYSNESQTVVQRIMAGFPYSARIG
FT                   LYAWVMALVLGISLGIIAALKQNTWIDYVSLFFATVGYTIPSFVLGIFLLIIFAVKLGW
FT                   VPVLFAGWKSYILPSVALGLSTAAFIARLTRASVLEIIRQDYIRTARAKGLPPRIINLR
FT                   HIVRNALIPVVTISGPALASLITGTIIIENVFNVPGMGYLFIQSISARDYPVIMGTTLF
FT                   YTFFIVIGNLLVDLTYGLVDPRIKTS"
     gtgcttaggt ttatagtcaa caggctttta tggatgattc cagtactgtg gcttgtgggg        60
     actgtaactt tcttcctgat gcatgctgct cctggcagcc cttgggatgt tcgagtggga       120
     ggaaaaaata tcagccctga gctggagaaa tccttcaaca ggaagtatgg tcttgacaag       180
     cctctagtag tgcaatacct gatctactgg cgcaacgtgc tcaagctgga tttcgggcaa       240
     tcctactcta atgagtcgca gactgtcgta cagcgtataa tggcaggctt cccgtattcc       300
     gctcgaatag gtctgtacgc ttgggttatg gcgcttgtgt tagggatatc tctaggaata       360
     atagctgcgc tcaaacagaa cacctggatc gactatgtga gtctgttctt cgctactgtg       420
     ggctatacta tccccagctt tgtgttaggt atatttctac taatcatctt tgctgtgaag       480
     ctgggatggg tgcctgtgct gtttgcgggc tggaagagct acatactacc tagcgtagct       540
     ctaggactaa gcaccgcagc tttcatagct aggctcacaa gagcgagcgt cctggagata       600
     atacggcagg actatatacg tacggctaga gctaaggggc taccgccgcg cataataaac       660
     ctcaggcaca tagttcgcaa cgccctaatt ccggtggtaa cgatctctgg acctgccctg       720
     gcatctctta taactggaac gattatcata gagaacgtct tcaatgtgcc cgggatgggt       780
     tatctattta tccaaagcat ctctgcacgg gattatccag tgataatggg caccactttg       840
     ttctatacct tcttcatagt aataggcaac ctgctagtgg accttacata tggcttggta       900
     gatccgcgca tcaagactag ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page