(data stored in ACNUC7421 zone)

EMBL: CP001825.PE420

CP001825.PE420       Location/Qualifiers
FT   CDS_pept        complement(458217..459236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0423"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /EC_number="3.1.3.26"
FT                   /note="KEGG: bsu:BSU29530 signal peptide peptidase;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41344"
FT                   /db_xref="GOA:D1CEI8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI8"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACZ41344.1"
FT                   /translation="METPAQPQHQTQPQPQPRKRSWIPIVVFLSALVVACVACVALAVL
FT                   MGRSVESTAESIHEEAVQGSGEWKIAIIPVTGTIQESAGGFTTSAATPESLKAMLDQAE
FT                   NDSKVKAIILEVDSPGGEVVASDEMYREILDFKQRTRKPVVVRMVSTAASGAYYISMAA
FT                   DKIVANPMTLTGSLGVIMEYMNFSKAADKVGISQVVIRSGEFKDIGNPFRDPTKEERQI
FT                   LQQLVDEAYNQFVNVIAQGRKMPTSRVRQLADGRVYSGQQAKQLGLVDELGNLDKAVQV
FT                   AEQLAGIKNAQVVRYRHSVSLLSLLSSRLQMSTEPDAMKILRSAGYDITPRLMYIYRP"
     ttggagacac ctgcacaacc acaacatcag actcaacctc aacctcaacc caggaagaga        60
     tcatggatac ctatagttgt gttcctatct gcactggtgg tagcatgcgt ggcgtgtgtg       120
     gctctggcag tactaatggg tagatccgtg gagagcacgg cagaatccat acatgaggag       180
     gcagtccaag gtagcggtga atggaagata gccataatcc ctgtaacagg gactatacaa       240
     gagagtgccg gaggtttcac cacctctgct gctacacctg aatctctgaa agctatgctc       300
     gatcaggccg aaaacgactc caaggtcaag gccattatcc ttgaggtgga ctctcccggc       360
     ggagaggtcg tagctagcga tgagatgtat agggagatcc tggacttcaa gcagagaaca       420
     cgtaagcccg tggtggtgcg tatggtcagc acagccgcct cgggggcata ctacatctcg       480
     atggccgcgg ataagatagt tgccaacccc atgaccctca cagggtcttt gggggtgatc       540
     atggaataca tgaacttctc caaggctgct gataaggtag gcataagcca ggtagtgatc       600
     cgtagcggag agttcaaaga tataggcaac ccgtttcggg acccgaccaa agaagagaga       660
     cagatcctgc agcagctggt cgacgaggcc tacaaccaat tcgttaacgt catcgcccaa       720
     ggccgcaaga tgccgacatc cagggtcaga caacttgctg atggtcgtgt ctattccggg       780
     caacaggcca aacagctggg gctggtagat gagcttggaa atctggataa ggctgtacag       840
     gtagcggaac agcttgcagg tataaagaat gcccaggtag taaggtaccg ccactcggtg       900
     tccctgctct cactacttag tagcaggcta cagatgtcga ccgagcccga cgctatgaag       960
     atcctcagat ccgccggtta cgacatcacc ccaaggctaa tgtacatcta ccggccgtag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page