(data stored in ACNUC7421 zone)

EMBL: CP001825.PE421

CP001825.PE421       Location/Qualifiers
FT   CDS_pept        complement(459249..459908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0646 DMT superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41345"
FT                   /db_xref="GOA:D1CEI9"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41345.1"
FT                   /translation="METLRILWAPNEEFPRLLKAGGTRWAVGTVSLLAFLNLITTLINL
FT                   NSGVLQLEQQYFPDVPRDVLQATQQAMKVLTPVAAATYPFITWLVLGVLMYLTGRVFGG
FT                   TGRLSSMLVVSGVSQLPLIVGLVAGSVLAAAASTTSPDSPAAAFLGSLSFSLLIGQFMW
FT                   MAWLAVTGIRHVHQLDPRKSTASCGLSCLGCLGVFFILMFVAAIILSLVITTRVSS"
     atggaaaccc tgcgaatcct ttgggcccca aatgaagaat tcccgcgact gctaaaagct        60
     ggcggcaccc gatgggcggt aggtactgta tcactgctgg cgttccttaa ccttattact       120
     accctgatca atctcaacag tggcgttcta cagctggagc aacagtattt ccctgacgtg       180
     ccgcgtgacg tcctccaggc cacccagcaa gcaatgaaag tgctaacgcc cgtagcagct       240
     gctacttacc cttttataac ttggctggtg cttggtgtac tcatgtacct tactggcaga       300
     gtgttcggtg gcacgggcag gctgtcatcc atgctagtgg tctcgggcgt atcccaactt       360
     ccgctgatcg tgggtctggt agcaggctca gtcctggcag cagccgcatc cactacatcc       420
     ccagatagtc cagcggcggc attcctgggc tcactgtcct tcagtctgtt gatagggcaa       480
     ttcatgtgga tggcgtggct ggcagttacg ggcatcaggc acgtacatca gctggatcca       540
     aggaagagca cggcctcctg cgggttatct tgcctgggtt gtctgggcgt attttttata       600
     cttatgttcg tggcagctat aatactaagt ctggtcataa ctacaagagt aagctcataa       660
//

If you have problems or comments...

PBIL Back to PBIL home page