(data stored in ACNUC7421 zone)

EMBL: CP001825.PE423

CP001825.PE423       Location/Qualifiers
FT   CDS_pept        complement(461080..462225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0426"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: vpa:VP0252 DNA-binding transcriptional
FT                   regulator CytR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41347"
FT                   /db_xref="GOA:D1CEJ1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ1"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACZ41347.1"
FT                   /translation="MPRSDQIDDKQNKLGKARRFQGASLRDVAKLAGVSVKTVSNVVNN
FT                   YPHVTEETRMRVQRALEELNYRPNLSARNLRNGKSGLIALAVPEIDFPYFSELARLVIK
FT                   VAGERGYTVLIDQTGGARDREKLVLAGIRPQMVDGIIFSPIETGKEDLLERRDDTPLVL
FT                   LGEGATDGILDHVGIDNVKAARVAVRHLLDLGRRRIAAIGAQPGVVVQTGHLRLRGYYE
FT                   ALQEAGIGIDQDLIARAPVYHRHEGAEAMRKLLELKDPPDAVFCFNDLLALGAIRTLIN
FT                   FGLRVPEDVAVVGFDDIEEASYSNPTLTSISPNKEQIARIAMSMLISRMEEGTTTPPRE
FT                   EQVDFRLIARESTLGVRCQEQVVYDSLQEDKARNNSALMEG"
     atgcctcgat cagatcagat agacgataag cagaataagc tcgggaaggc cagaaggttc        60
     cagggtgcaa gcctaaggga cgtggccaag cttgctggag tgtcggtcaa gaccgtgtcc       120
     aacgtagtca ataactatcc ccatgtgacc gaggagacca ggatgcgtgt gcagcgcgcc       180
     ctcgaggagc tcaattatcg gcccaacctg tctgccagga acctgcgtaa tggtaagtcg       240
     gggcttatcg ctcttgccgt accggagatc gacttcccct acttctcaga gctagcacgc       300
     ttggtcatca aggttgccgg agagcgagga tacacggtgc ttatcgatca aacaggtggc       360
     gcaagggaca gagaaaagct cgtactggca ggcatacgcc ctcagatggt agatggcatt       420
     atctttagcc ctatagagac ggggaaggag gatctgctgg agcgaaggga cgatactccc       480
     ctagttctgc tcggcgaggg ggccaccgac ggcatactgg accacgtagg catagacaac       540
     gtcaaggccg cgcgcgtggc tgtacgacac ctgttggatc tcggtcgaag gcgtatcgca       600
     gcgatcggtg cacagcctgg ggtcgtcgta cagaccggac acctgcgact cagaggatac       660
     tatgaagccc tgcaagaggc aggtataggg atcgaccagg accttatagc cagggcgcca       720
     gtttatcata ggcatgaggg cgccgaggcc atgagaaagc tgctggaact caaggacccg       780
     ccggatgcgg tgttctgctt caatgatcta ctcgcactgg gtgccataag gacccttata       840
     aactttgggc tgagggtacc cgaggacgtc gcggtagtag gcttcgatga catagaggag       900
     gctagctaca gcaaccctac actcaccagt atatctccca ataaggaaca gatcgcacgc       960
     atcgcgatgt ccatgctgat atctcgcatg gaagaaggca ctacaactcc tcccagagaa      1020
     gaacaggtag actttagact gatcgctcgc gaaagcactc ttggcgtaag atgccaggag      1080
     caggtagtct atgactctct acaggaggac aaggcaagga acaatagtgc cctgatggag      1140
     ggctag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page