(data stored in ACNUC7421 zone)

EMBL: CP001825.PE424

CP001825.PE424       Location/Qualifiers
FT   CDS_pept        462651..464144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0427"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: atc:AGR_L_3413 putative sugar transporter sugar
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41348"
FT                   /db_xref="GOA:D1CEJ2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41348.1"
FT                   /translation="MSEERQERSSSLLTRRQALKAIGMGAVGIALAACGGGAGSTPTAP
FT                   VGGQVSTPTSSPQPSPTTAPSPSASPGGKPTVAPTPLPPTPVVQEIGRGTEKVIFWHGL
FT                   GGADGETMQVLLQKYTKEKGIAVRSETYDWGLFYQKLPTSIIAGTPPDMAIMHEWAMAQ
FT                   FGTQGVLQSADDLFFNAGILDKSDYNEEILKKITIDGVAYGVPWDNHGWGLWYNTKLIK
FT                   DAGLDPNKLPKNGQEYLEWCYKLTTDENGKHPDENGFNPKKVAVYATHPSWLRPTLLST
FT                   IWQFGGEVFDPVKKKASLDSENCIKAVQYWVDLVHEHRVAAPTGAGTTSPADLYANNRL
FT                   VLMWEGSWMLNFFKDRPKLLPPVTKAASLPSLSDGTQAAWMSAHIFVIPNGIEGDRLER
FT                   AKNLIKWLEDHNAEWADSGQVPAKLSVQNSGIIQKLWSVSAFAKEFQTIGRTEPQHVAI
FT                   TEIQAQYEPAFDAALNKVMSVKDALTQANRRIQDILDRY"
     atgagcgagg agaggcagga aagatctagc agtttgctta caagaaggca ggcgctcaag        60
     gcaataggta tgggagccgt ggggattgcc ctggcggcat gtggtggcgg ggctggctcc       120
     acgccgacag ctcccgttgg tggtcaggta agtaccccta ccagtagtcc tcaaccatcg       180
     ccgaccaccg caccttcgcc gagcgcttcg cccggtggga agccgaccgt ggccccaact       240
     ccccttcctc ctacgcctgt cgtgcaggaa ataggaaggg ggactgagaa agttatcttc       300
     tggcatggtc ttggcggtgc agatggggag actatgcagg tcctgctgca gaagtacacc       360
     aaagagaaag gaatcgctgt taggtctgag acctacgact ggggcctgtt ctaccagaag       420
     cttccgacct ctataattgc gggcacacca cctgacatgg cgatcatgca cgaatgggcc       480
     atggcccagt ttggtacgca gggggtgctg caatcggccg atgacctatt cttcaacgct       540
     ggtattctag ataagagcga ctacaacgag gagattctga agaagatcac tatagatggt       600
     gttgcctatg gtgttccctg ggacaaccac ggctggggac tctggtacaa cacgaagctt       660
     ataaaggatg ccggcttgga tccgaacaag cttcctaaga acgggcagga gtacctggag       720
     tggtgctata agctcactac tgatgaaaac ggcaagcatc cggatgagaa cgggttcaac       780
     cccaagaaag ttgccgtgta cgcaacgcac ccttcctggc tgaggcccac actgctgtcc       840
     acgatctggc agttcggtgg agaggtgttt gaccctgtga agaagaaggc ttcgttggat       900
     agcgagaact gcatcaaggc tgtccagtac tgggttgacc tggtccacga gcatagggta       960
     gctgctccca caggcgctgg cactacatcg ccagccgacc tgtatgccaa taacaggctt      1020
     gttctgatgt gggagggcag ctggatgcta aacttcttca aggataggcc taagcttctg      1080
     ccacctgtta ccaaggctgc atccttgccc tctctgtccg atggcactca ggctgcctgg      1140
     atgagcgctc acatattcgt aatccccaat ggtatagagg gtgatcgtct tgagagagct      1200
     aaaaacctga tcaagtggtt ggaggatcac aacgctgagt gggcagactc cggtcaggtg      1260
     cctgccaaat tgtctgtaca gaacagcggt attatccaga agctctggtc tgtgagtgct      1320
     ttcgccaagg agttccagac tatcggacgc actgaaccac agcatgtggc cataaccgag      1380
     atacaggccc agtatgaacc agcgtttgat gctgcattga ataaggtgat gtcggtcaag      1440
     gatgccttga ctcaggccaa tcgcaggatt caggatattt tggatcgcta ctag            1494
//

If you have problems or comments...

PBIL Back to PBIL home page