(data stored in ACNUC7421 zone)

EMBL: CP001825.PE426

CP001825.PE426       Location/Qualifiers
FT   CDS_pept        465165..466028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0429"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_460 lactose
FT                   transport system permease protein lacG"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41350"
FT                   /db_xref="GOA:D1CEJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41350.1"
FT                   /translation="MASAIAKVSFRRISLELVITYVYLIALGIITLAPIAYMVSQAFTP
FT                   EADQNQWPVRWLPEHPTVNNFQRLLADPTLPVLRWLFNSFFVSTSVMLLTLLLCSLAAY
FT                   AFARLEFPGRDVIFFIILISLMIPGAVTFIPVFLLMRDLKFLDTYNALIWPAGANAFGV
FT                   FMLRQYFITIPKELEEAALVDGANRFRIYWQIALPLVSPALVALGIFTFLGSWNDLFWP
FT                   LVVLSERTMYTLPVGLAFLGQGNYVQQGLTMAAATLASAPVLIVYAIFQRRIVQGIALT
FT                   GGLGGR"
     atggcctctg ctatcgctaa ggttagcttt cgcaggatat ctctggaatt ggtgataact        60
     tacgtatatc tgatcgcgct cggcataatt acgctggctc ctatcgcgta catggtgtcc       120
     caggcattta cacccgaggc agaccagaac caatggccgg tcaggtggtt accagagcat       180
     ccaacggtga ataattttca acgcctgctt gcggatccta ctcttccggt actcagatgg       240
     ctgttcaaca gcttcttcgt gtcgaccagt gtgatgctcc tgactctgct gctgtgttcg       300
     ctggctgctt atgcttttgc tcgcctggag ttcccaggaa gggacgtgat attttttatc       360
     atccttataa gcctgatgat acctggagct gtaactttca tacccgtgtt cctcttgatg       420
     cgcgacctaa agttccttga cacctataac gcacttatat ggcctgcagg tgccaatgcc       480
     ttcggggtat tcatgctcag gcagtatttc ataactattc ctaaggagct ggaagaagcc       540
     gctctcgtcg atggagccaa tagattcagg atttactggc agatagctct tccgttagta       600
     tcgcctgcat tggtggctct gggtatcttt acgttccttg gctcttggaa tgacctgttc       660
     tggccgttgg tcgtgctcag cgagaggact atgtacactt tgccagtggg gctggccttc       720
     ctggggcagg gcaactatgt acagcaaggc ttgactatgg cggctgctac gctggcttct       780
     gctccggtac ttatagtcta cgctatcttc caaaggcgca tagtgcaggg tatagccctg       840
     actggtggac tgggaggcag gtag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page