(data stored in ACNUC7421 zone)

EMBL: CP001825.PE427

CP001825.PE427       Location/Qualifiers
FT   CDS_pept        466067..468838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0430"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   glycoside hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; glycoside hydrolase family 2 TIM barrel;
FT                   KEGG: rle:pRL90127 putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41351"
FT                   /db_xref="GOA:D1CEJ5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ5"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACZ41351.1"
FT                   /translation="MRDRICLDGTWDFCVDKDRSFSSADVAFEDTIDVPSAWQAAKPEL
FT                   RRYTGRAWYRKTIDYPDLPNDRVFRLCFGAVDHECTVWVNGVEVGRHSGGYTPFRLDVT
FT                   HALRSGRNEILVMVDDWGYRYQWAPRWLDQEVDPEFEKAASILHGKQTWYADVSGIWQS
FT                   VWLESLPVAHINGVKIYTDPQSGSVTFRVATSEAANGKELWVEVLDQGQVCAAASGLVA
FT                   GSTCELTLQLTNPKLWSLDSPNLYEACVRCGEDTVTERFGVRSFEARDGKFFLNGSPLY
FT                   MRGALDQDFYPGTIYAPPSKEYVYEQFRLAKELGLNTMRCHIKVPHPWYLEVADELGIL
FT                   IWEEIPSWGTVGREPNSYNVKPVPESTRREVLQTLEEMVDRDFNHPSLVIRTIVNEDWG
FT                   THLVMSQEDRSWLKQMYHKAKELDPTRLVVDNSACYGSRGPNLHVKSDINDFHVYALMP
FT                   DEYQFFASWVEHFAQAPLWTWSPYEDSEPRGDEPLVVSEFGNWGLPSLEPTKEDAEQEG
FT                   EPWWFMTGGWGGGIASEATHPTGVARRFHALGLDRVWDSYEDLARGTQRHQYEALRAEI
FT                   EVMRLYPSIVGYVITEFTDAYWEANGLLDFYRNPKYLHEKFSLINTDDVLIPDRRRGSY
FT                   WAGEELKVPIRYSKWSEGSISGAGVYYASKQLGGGRQQLSADITAQQGQVVNAGEIKLR
FT                   LPDVDSPTLIEIEVWLEHGGRKLAANTLELMCLPAISRRTSADVPLAVVAPESNLSTRL
FT                   RSMGCDLVSDLKDAEIAVATRVTPELDRWVKGGGKLLLVADETCPYLFTRPRAGSPWQG
FT                   NWCQSWTWILPGSFSRVYVQNPLGFLFREVMPRHVIMGYMPEHNADVLAGMFVGWLALP
FT                   AAVTTKYRVGKGMVLHTTFDLARSEAPVSDAMLADLVDHIASPEFYPERRLV"
     atgagagaca ggatctgttt ggacggtaca tgggattttt gcgttgacaa ggatcgcagc        60
     ttcagctctg ctgatgtggc ctttgaggac acgatagatg ttccctccgc ctggcaggcg       120
     gctaagccgg agctgagaag atataccggc agggcttggt acaggaagac catagactac       180
     cctgatctgc ccaacgacag ggtgtttcgc ttatgctttg gggccgtgga tcacgaatgt       240
     acggtctggg taaatggcgt cgaagtgggt aggcatagtg gagggtatac gcctttccgt       300
     ctggatgtta ctcatgctct acgctcaggc aggaacgaga tcctcgtcat ggtcgatgac       360
     tggggctata ggtaccaatg ggctcctaga tggcttgacc aggaggtgga tccggagttc       420
     gaaaaggcag ccagcatcct ccacggcaag cagacctggt atgcagatgt atccggtata       480
     tggcagagcg tgtggctaga gtcgttgcca gtcgcacata tcaacggtgt caagatctac       540
     acggacccac agagtggtag cgtgacgttc agagtagcaa ccagcgaggc tgctaacggc       600
     aaggaactgt gggttgaggt gcttgaccaa ggccaggtgt gtgccgccgc ctccggtcta       660
     gttgcagggt ctacttgcga actgaccttg caactgacaa atcccaagtt atggtcgtta       720
     gattcaccca atctgtatga ggcttgcgtt aggtgtgggg aagataccgt aaccgagagg       780
     tttggcgtta gaagcttcga ggccagggat ggaaagtttt tcctgaatgg ttcccccttg       840
     tacatgcggg gggctctgga tcaagatttc taccctggta ctatatatgc ccctccaagc       900
     aaggagtacg tctacgagca gttcaggctt gcgaaggagc ttgggttgaa caccatgaga       960
     tgtcacataa aggttcctca cccctggtac ctcgaggtgg cagatgagct ggggattctt      1020
     atctgggagg agattccctc ctgggggacg gtgggcagag agcccaattc ctataacgtc      1080
     aagcctgtgc ctgagagcac gaggagagaa gtcctgcaga ctcttgaaga gatggtagat      1140
     cgcgatttca accatccttc actggtgatc agaaccatag ttaatgagga ctggggcacc      1200
     catcttgtga tgtctcagga agatcgcagc tggctgaagc agatgtacca caaggctaag      1260
     gagcttgacc ccaccaggct ggtcgtagac aactccgcct gttacggtag ccgaggcccc      1320
     aacttgcacg tgaaatccga cataaacgac ttccatgttt atgcccttat gcctgatgag      1380
     taccagttct ttgcaagttg ggtagagcac tttgcgcagg ctcctctatg gacttggagc      1440
     ccgtacgaag actccgaacc caggggggat gaacccctag tggtgagtga gttcgggaac      1500
     tggggattgc catctttgga gccaactaaa gaggatgcgg agcaggaagg tgagccctgg      1560
     tggtttatga ctggtggctg gggtggcggt atcgcctccg aggccacaca tcccactggg      1620
     gtggcaagaa ggttccatgc gctcggcctg gacagagtat gggattctta tgaggatctt      1680
     gcacggggaa ctcagaggca ccagtacgaa gctctgaggg cggagataga ggtgatgagg      1740
     ctgtatccgt ccatcgttgg gtatgtcatt actgagttca ctgatgcata ctgggaagct      1800
     aatggtctgc tggatttcta ccgcaatcca aagtaccttc acgagaagtt tagcctaatc      1860
     aatacggatg atgtcttgat ccctgacaga agacgtggct cctactgggc tggcgaggag      1920
     ctgaaagtgc ccattagata ctctaaatgg tctgagggta gcatttcggg agccggtgtc      1980
     tactacgcca gcaagcagct aggaggggga aggcagcagc tctccgcaga tatcaccgct      2040
     cagcagggcc aggtggtgaa tgctggcgag atcaagctca gattgcctga tgtcgattcc      2100
     cctaccctga tcgagatcga ggtatggctg gagcatggag gccgtaaatt ggcggctaat      2160
     actcttgagc taatgtgcct gcccgcgatt agcaggagga ctagtgcaga tgtccctctt      2220
     gccgtagtag ctcctgagtc caatttgtcc actagactca ggagcatggg ctgtgacctg      2280
     gtttcggatc tgaaggatgc tgagatcgcg gtggcaacta gagtcacacc cgaactagat      2340
     aggtgggtga agggtggggg caagttgctg ctcgtggcag atgaaacctg tccctacttg      2400
     ttcactaggc ccagagctgg tagtccctgg cagggcaatt ggtgccaaag ctggacctgg      2460
     atcttgccgg gcagcttctc acgagtatat gtccagaacc cattaggctt tcttttcagg      2520
     gaggtcatgc ctaggcacgt aattatggga tacatgcctg agcataacgc cgacgtgctt      2580
     gctggtatgt tcgtgggttg gctggcactg ccggctgctg taaccactaa gtatagagta      2640
     ggcaagggta tggtcttgca cacaaccttt gacctcgctc ggagcgaggc tccggtttca      2700
     gatgccatgc tggcggacct tgtggaccat atcgcctctc cagagttcta tcctgagcgt      2760
     cgtctagtgt ga                                                          2772
//

If you have problems or comments...

PBIL Back to PBIL home page