(data stored in ACNUC7421 zone)

EMBL: CP001825.PE429

CP001825.PE429       Location/Qualifiers
FT   CDS_pept        470676..472802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0432"
FT                   /product="Amylo-alpha-16-glucosidase"
FT                   /note="PFAM: Amylo-alpha-16-glucosidase; KEGG:
FT                   aba:Acid345_3259 amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41353"
FT                   /db_xref="GOA:D1CEJ7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ7"
FT                   /inference="protein motif:PFAM:PF06202"
FT                   /protein_id="ACZ41353.1"
FT                   /translation="MDYLVISDNHTFMVCEFSGDILQNDKPNGLYYRDTRYLSLLHMYL
FT                   AGQSLDVLSHDDDTTYQANIILTNRRFEDEDGTRIPAGTLTVSRSYAVHGSLSQRLVLQ
FT                   NFNNFQVRTVLAMDLAADFMDMFEVRGIASGQRGELLDPHIEGNTVVLTYLGQDGVTRK
FT                   LYIFFAISPSRVHTQDSGGTHVVRAEWDVDLTPQGTMDIEMIFEPVESEPVEVRRHAHE
FT                   GAKVYNLILRRQRHETESWLDGSTKFFTDNVDLNNLIERSTLDIKALTGEYPTGRAIHA
FT                   GIPWFAVPFGRDSIITSMQTLPLNPDLAIATLRFLAKYQGKEDDPWRDEEPGKIMHEMR
FT                   FGELANRKLIPHTPYYGSVDATPLFVMLFAQVVRWTGDRALYSELLPSVMRALEWIDRW
FT                   GDLDGDGFLEYKTRSELGIRNQGWKDSQDSILYPDGSLVSPPIALVEVQAYAYAAKLWL
FT                   SQLVAEMGDQELANRLASEAANLKEAFNKHFWVSEASFFAQGLDDRKVPIKDITSNPGH
FT                   ALMCDIVDAELLPAFVHRLMQPDMLSGWGIRTRSLHDPNFNPVSYHNGSVWPHDNSLII
FT                   YGLYKNGFRDEANEVSYQILEASRYFRLNRLPELMCGFQRDEDNLRRPAEYPVSCSPQA
FT                   WAAGTVFMMLRSMLGIEADGLNHTLRLSPSLPAWIESIEVSNLRVAHERVHFAVSRDGE
FT                   VEVISRGDITILVE"
     atggattatc ttgtgatatc ggacaatcat accttcatgg tgtgtgagtt ctccggtgat        60
     atccttcaaa acgataaacc taatgggctc tactacagag acacccgcta cctaagccta       120
     ttgcatatgt accttgcagg gcagagcctg gacgtgctaa gccacgatga cgacaccact       180
     tatcaggcca atatcattct cacgaaccgc cgctttgaag atgaggatgg tacaaggata       240
     cctgctggta ctttgacagt tagcaggtct tatgcagtgc atggttcgtt gtcgcagagg       300
     cttgtcctgc agaatttcaa caacttccag gtgcggacag tgctggctat ggacctggct       360
     gcagatttta tggatatgtt tgaggtccgt ggcattgcct caggacagcg cggcgagctc       420
     ttagatcctc atatagaagg taatacggta gttttgactt atctggggca ggatggtgtt       480
     actaggaagc tgtacatctt ctttgccatc tcgccctctc gtgtgcacac acaggactct       540
     ggtggtaccc atgtggtgag agctgagtgg gatgtggacc tcacccctca gggcactatg       600
     gatatagaga tgatctttga gccggttgag tcggagccag tggaggtccg taggcacgcc       660
     cacgaagggg ccaaagttta caatctcatc ctcaggaggc agaggcacga gacggagtct       720
     tggctcgatg gtagcaccaa gttcttcaca gataatgtcg atctaaacaa cctcattgag       780
     agaagcactt tagatatcaa agcgcttacg ggcgagtatc ccacaggtag ggcaattcat       840
     gcgggcatac catggttcgc ggtgcccttc gggcgtgact ctatcatcac tagcatgcag       900
     actttacccc tgaacccaga cctagctata gctacgctca ggttcctggc aaagtaccag       960
     gggaaggagg atgatccctg gagagatgag gagcccggca agatcatgca tgagatgcgg      1020
     tttggggaac ttgcaaacag gaagctgatc ccgcataccc cttattatgg cagtgtggat      1080
     gctactccac tgttcgtgat gctgtttgct caggttgtga ggtggaccgg cgatagggct      1140
     ctctattcag aacttctgcc ctctgtcatg agagctttgg aatggattga tagatgggga      1200
     gatcttgatg gcgatggctt cctggagtac aaaactagat ccgagctagg catcaggaac      1260
     cagggatgga aagattccca ggattctatt ctatacccgg atgggagctt ggtctctcca      1320
     cctatagcgc tcgtagaggt gcaagcttac gcgtacgctg ccaagctatg gctatctcag      1380
     cttgtagccg agatgggaga tcaggagcta gccaataggt tggcatctga ggcagctaat      1440
     ctgaaggaag ccttcaacaa gcacttctgg gtatcggagg ctagcttctt tgcgcaaggg      1500
     ctggatgaca gaaaagtgcc tatcaaagac ataacaagca atcctggtca tgccctgatg      1560
     tgtgatatag tcgatgctga gctgctgcct gccttcgtgc ataggctcat gcagccagat      1620
     atgctttccg ggtgggggat caggacacgt agcttgcatg atcctaattt taaccccgtg      1680
     agctatcaca acggcagtgt ttggcctcac gataactctc tgataatata tggtctttat      1740
     aagaatggtt tcagggatga ggccaacgaa gtctcctatc agatattgga ggcctctcgg      1800
     tacttcagac tcaataggct ccctgagcta atgtgtggct ttcagagaga tgaagataac      1860
     ctgaggagac ctgcggaata tccagtcagc tgtagtcccc aggcatgggc tgcaggcaca      1920
     gtcttcatga tgttgcgcag catgctgggc atcgaggctg atggcctgaa ccatactctg      1980
     aggcttagtc ctagcttgcc agcctggata gagagcatag aggtatcaaa ccttcgagtg      2040
     gcacatgaaa gagtgcactt tgctgttagc agagatggag aagttgaagt aatatctagg      2100
     ggagacataa ctatcctagt agagtaa                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page