(data stored in ACNUC7421 zone)

EMBL: CP001825.PE43

CP001825.PE43        Location/Qualifiers
FT   CDS_pept        complement(46206..46901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0044"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: bcb:BCB4264_A0291 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40967"
FT                   /db_xref="GOA:D1CDG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG1"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ACZ40967.1"
FT                   /translation="MPFKIERMKVEDIPEVAEIDRISFSTPWPPSAYRREIEHPDRNYY
FT                   IVLRRVGEGPLKDKDMSRHGVLANILPFLKDEKLEPNPNPIIGYAGLWIIGEEAHVTTI
FT                   AVLPQFRGKKLGELLLVSLIDYARKNGVHRMTLEARVSNHVAQTLYRKYTFKNAGYRRR
FT                   YYSDNGEDALVMWSDRIDTDEFANKFESLKRELFEKLNGQLLLEDDSMEDASHRHVGEH
FT                   IEHVDRESP"
     atgcccttca aaatcgagcg catgaaggtt gaagatatcc ctgaagtggc tgaaatagat        60
     cgtatatctt tttcaactcc ctggcctcct agtgcttaca gaagagagat agagcacccg       120
     gataggaatt attacatagt gcttcgcaga gtcggagaag ggccccttaa ggacaaggat       180
     atgagcaggc atggtgtact agcgaatatc ctgccttttc taaaggatga gaagttagag       240
     cctaatccca atcccattat tgggtacgcg gggctttgga tcattgggga ggaggcgcac       300
     gtgacgacta tagccgttct tccccagttc agaggaaaga aattaggtga gctattgtta       360
     gttagtctta tagactatgc taggaagaat ggtgttcata ggatgactct tgaggccagg       420
     gtttcgaatc acgtagctca gaccctgtat cgcaagtaca ccttcaaaaa tgctggctac       480
     agaaggcgct attacagcga caatggggaa gatgctcttg taatgtggtc ggaccgtata       540
     gatacagatg agtttgccaa taagtttgaa agtctcaagc gcgagctttt tgaaaagctg       600
     aatggacagc tgctattgga ggatgattct atggaagatg cctcccatag acatgttgga       660
     gagcatatag agcatgtaga tagggagtct ccttag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page