(data stored in ACNUC7421 zone)

EMBL: CP001825.PE430

CP001825.PE430       Location/Qualifiers
FT   CDS_pept        472820..473836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0433"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcb:BCB4264_A2807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41354"
FT                   /db_xref="GOA:D1CEJ8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ8"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ41354.1"
FT                   /translation="MIPVYTEVPTGPKITLSDQDLAVIAQNYGLGAILDKKLLNGAVNT
FT                   IVLLKTSQGAFVARAHRPWTTAERLESVHTVMQSLKDRGFPVPKVGRTLDDRTWIQIRD
FT                   RLVELQEYIPHDACIDSWDLYMHSFEILAKMHEYLLTLHVDHLFPPLVSTYVTPEQALK
FT                   MLEDTDAICVEKARELGAEDALHIRQQARDILEALDREWKGYADRLPRQVVHGDYGWSN
FT                   VLVKGGRIVGIIDFDFMAERERVFEVAYSLYWAFDRLEGDNWQNGFFPRVGRLVDRYNY
FT                   LSRWPLLDVEISVLPYEMARVPLYWIAEAGYTPDPIGQIMLYSRHLPKARKLLELAG"
     gtgataccag tgtacaccga agttcctacc ggccctaaga ttaccctcag tgaccaggat        60
     ctggcggtta tcgcccaaaa ctatggattg ggggcaattc tagataagaa gctgctgaac       120
     ggggccgtga acactattgt gctcttgaag acctctcagg gagcattcgt agctagagcc       180
     catagaccat ggaccacagc tgagcgtcta gaaagcgtac acaccgtgat gcagtcgctt       240
     aaggataggg gatttcccgt ccccaaggtc ggtaggactt tggacgatag aacctggata       300
     cagatcagag ataggctggt cgagctgcaa gagtatatcc cccacgatgc atgtatagac       360
     agctgggacc tttatatgca ctccttcgag atcttggcga agatgcatga gtatctactt       420
     acgcttcatg tagaccatct attcccccca ctggttagca cttacgttac ccctgagcaa       480
     gctctcaaga tgctggaaga cactgatgct atatgcgttg agaaggcaag ggagttgggc       540
     gcggaggacg ccctgcatat caggcaacag gctagagata tcctggaggc cctcgatcgt       600
     gagtggaagg gctatgcaga taggctacca cgacaggtag tacatggcga ttatggctgg       660
     agcaatgtcc tggtaaaggg tggtaggata gtaggtatca tagatttcga tttcatggct       720
     gagcgtgagc gcgtttttga ggtagcttac agtctatatt gggcttttga ccgcctagaa       780
     ggagacaact ggcaaaatgg ctttttcccg agggtaggca ggcttgtgga ccgctacaac       840
     tacttatcaa gatggccact tctggacgtg gaaatcagtg tgctgccata tgagatggca       900
     agggtcccac tttattggat agccgaagct ggatatactc cagacccgat aggtcagata       960
     atgttatatt caaggcatct acccaaggcc agaaagcttc tggagcttgc aggctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page