(data stored in ACNUC7421 zone)

EMBL: CP001825.PE434

CP001825.PE434       Location/Qualifiers
FT   CDS_pept        complement(477200..477505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41358"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR018684"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41358.1"
FT                   /translation="MSQGGVIDQIREGMEVLSSDGQKLGKIKNIWYGAASGMSSAYSDE
FT                   ESCIEVRSGGLFSKETLYIPFREIVDVSGNNVKIKADAQTVHKNPAWHTKPSWIGQ"
     atgtcgcagg gaggagtaat tgaccagata agagaaggca tggaagttct atcctcggat        60
     ggccaaaagt tgggcaagat caagaacatc tggtacggag cagcttctgg tatgtcgtcc       120
     gcatacagcg acgaggagag ttgcatagag gtcagaagcg gagggttgtt cagcaaggag       180
     accctttaca taccattccg cgagatcgta gatgtatctg gtaacaacgt caagattaag       240
     gctgatgccc agactgtaca caagaatcca gcttggcata caaagccttc atggataggc       300
     caataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page