(data stored in ACNUC7421 zone)

EMBL: CP001825.PE436

CP001825.PE436       Location/Qualifiers
FT   CDS_pept        479470..480756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0439"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: bcy:Bcer98_0348
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41360"
FT                   /db_xref="GOA:D1CEK4"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK4"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ACZ41360.1"
FT                   /translation="MSSLQVSSESGVLRKALVHTPGGELSMVAPSRLRDFLFSDILYEK
FT                   GAREEHLTLVKVLREIFNVEVLQFTALLEEALSSSDPLDKLRLVEGVSDLEGLHAEDTI
FT                   KLKAAFEDESQNDASYLARLLITGKLVGSDLSISDFIRHNLYQLQPVPNLMFVRDLAAV
FT                   IGQEMFVGWNSQKVRRRENLLWRFILQHASIGQDITWHNWMMEDENSSPCYLEGGNILQ
FT                   PRPNILLIGHGVRTNSSAVERLIRHLQNVMEDTCYLFVIMLPDYIPHLDAVLSAISPFE
FT                   YVAFPPAVKGHSQYSVDVLQVVLQQGKQPKTQVVDLLDSLQSTIGEPLDIIPCGGSDTV
FT                   TQKREYWWGGASLLTVSPGKIISYNSPENTLNELSKRGYKIIQATDALSNPDSIRSCER
FT                   CVITLRGLELTRARGGPRSLVMPLVREGV"
     atgagtagtt tgcaagtgag ctccgagagc ggtgtgctcc ggaaggccct ggtacatacc        60
     ccaggggggg agctctccat ggttgctccc tccaggctgc gtgactttct atttagcgat       120
     atcctctatg agaagggtgc cagagaggaa caccttaccc tggtaaaagt cttacgggaa       180
     atatttaatg ttgaggttct ccagtttacc gccctccttg aggaggcttt gtcctcctca       240
     gatcctttgg ataagctcag gttagtagag ggtgtgtcag atttggaagg gctgcacgct       300
     gaggatacca tcaagctaaa agccgctttc gaggatgaat cccaaaatga tgccagttac       360
     ttggctcgtc tactgataac tggtaagctc gtaggctcgg acctctcgat ttccgacttc       420
     ataaggcata atctatatca acttcagccc gtaccaaacc tgatgtttgt gcgcgacctg       480
     gcggctgtca tcggtcaaga gatgtttgtg ggatggaact ctcagaaggt gcgcagacga       540
     gaaaacctgt tatggaggtt tatcctgcag catgcctcta tagggcagga tatcacgtgg       600
     cataactgga tgatggagga tgagaacagc tctccttgct acctagaagg agggaacatc       660
     ttgcagccta gacccaatat tttgctgata gggcatggcg ttcggaccaa ctcttcggca       720
     gttgagaggc ttataaggca ccttcagaat gttatggagg atacctgcta cctgtttgtg       780
     attatgcttc cggactacat acctcatctg gatgcggtgc tatcggcaat ttctcccttc       840
     gagtatgtag cctttcctcc ggcggtcaag gggcacagtc aatactctgt ggatgtgctc       900
     caggtagtac tacaacaagg caagcagcct aagacgcagg tggttgatct acttgattct       960
     ctgcagagta cgataggtga acccctagat atcatcccct gtggaggaag cgatacagtt      1020
     actcagaagc gtgaatactg gtggggggga gccagcttac ttaccgtctc gcctgggaag      1080
     attatttctt acaactctcc agagaacact ctaaatgagc ttagcaagag gggttataag      1140
     atcattcaag ctaccgatgc gctaagtaat cccgatagca tccgctcttg tgagagatgt      1200
     gtcataaccc tgagaggttt agagttgacc agagcaaggg gcggccccag aagccttgtg      1260
     atgcctctgg tcagggaagg agtttaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page