(data stored in ACNUC7421 zone)

EMBL: CP001825.PE437

CP001825.PE437       Location/Qualifiers
FT   CDS_pept        480757..482052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0440"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: sus:Acid_4006 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41361"
FT                   /db_xref="GOA:D1CEK5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK5"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ41361.1"
FT                   /translation="MVNRPSIVLVTCHDLGTYLHCYGVPTPATPNLDRLAGEGLQFTNA
FT                   FCVAPQCSPSRSAIATGRYPHSNGVMGLTHHPFDWDLYPDEKHIAQILKDLGYATFLLG
FT                   HQHVTTNPSRLGFDLMFHDRRGEAVVNEFRRIVQAHDFQASPAYFEINLNQTHRPYEGE
FT                   GLDVQSQREVFVPGFLPEAPESRDEMLQFYRSVEVADKLVGDVLEIVDQYGLRNEIIFV
FT                   FTTDHGIAMPRAKCTLYDPGLRVSLLLRWPAGSFPTGQKIDSLVSNVDILPTLLAMIGI
FT                   DPLPEFLQGKSFLPSMVDDRAVRDEVFAEKTFHSYYDPMRAIRTDRYKYIVNFESSFLV
FT                   EVPGDIQMGVIFRRFTQLYSATQHPVIELYDLESDPLEEHNLAGNPDYADIERDLRGRL
FT                   LQWMEATDDPLLQGPVASPSYRKALNVLKESP"
     gtggtgaatc gtccctctat agtgctcgtg acatgtcatg atcttggtac ttatctacat        60
     tgttatggcg tacccacccc tgccacacct aacctggaca gattggcagg tgaggggcta       120
     cagttcacta atgctttctg tgtggcccct caatgcagcc caagcagatc ggcgatagcc       180
     accgggcgtt atccacatag caacggagta atgggactga cccatcatcc cttcgattgg       240
     gacctatatc ctgatgagaa acatatagct cagatactca aagacttagg ctatgctact       300
     ttcctgctag ggcatcagca cgttactact aacccatcaa ggttaggttt tgacctgatg       360
     tttcatgaca gaagagggga agctgtagta aatgagttca ggagaatagt gcaggctcac       420
     gatttccagg cttctcctgc ctacttcgaa ataaacctga accagactca tcgtccatat       480
     gaaggtgaag gcttggacgt acagtcccag cgtgaggttt ttgttcccgg ctttctacca       540
     gaagccccag agagcaggga tgagatgctg cagttctatc ggtctgtgga ggtagccgac       600
     aagctggtag gggatgttct agaaattgta gatcagtacg gcctcaggaa tgagattata       660
     ttcgtgttta ctacggatca cggcattgcc atgcccagag ccaaatgtac gctctatgat       720
     ccgggattac gtgtatctct gttgttgagg tggcctgctg gctcatttcc aaccgggcaa       780
     aagatcgatt ccctggtgag caatgtcgat atactcccca ctctacttgc tatgatcggt       840
     atcgatcctc tgccggaatt cctgcagggg aaatctttcc ttccgtcgat ggtagatgat       900
     cgcgcggtac gtgatgaggt gtttgctgag aagaccttcc acagctatta cgatcctatg       960
     cgcgcgataa gaacggatag gtataagtac atagttaact ttgaatcaag cttcctggta      1020
     gaggtgcctg gcgatatcca gatgggagtt atattccgca ggttcactca gctttacagt      1080
     gcaacacagc atccagtgat cgagctgtat gatctggagt ctgatcccct ggaggagcat      1140
     aacttagcag gtaatcctga ttatgctgac attgagagag atctcagagg aaggcttcta      1200
     caatggatgg aggccacaga cgatcctctg ctccagggac ctgtagcctc cccaagttat      1260
     cggaaagctc tcaatgtatt aaaggaatcg ccttag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page