(data stored in ACNUC7421 zone)

EMBL: CP001825.PE438

CP001825.PE438       Location/Qualifiers
FT   CDS_pept        complement(482049..484493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41362"
FT                   /db_xref="GOA:D1CEK6"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41362.1"
FT                   /translation="MKNSLVAIFATALLCLTVLTTPSVKAVGDYGNVEGRVTYNGLPVK
FT                   GASISAGGQSVISDSQGRFRFDPLLVQDSWRAINVTVRASGLGVWRLYNAVIIPNDTLR
FT                   LDVKLSKHDVTLSQPLPGTTKNNLAPSKVSPEQDQNLKPAATTLGSQKVPPGVIRVYVT
FT                   DKTGLSPEDMWSCRYDPVPKGEVVEVPFKDYVKHVLPNEWFASWDMESLRAGAMAVKSY
FT                   AWYYVSRGGKWYWLGADVMDTTCDQVYNPAVSYASTDQAVENTWYQRLTENGYIVPAFY
FT                   RAGTKGDPGEQGSDVMSQWGSQYWATKGKTWDWILHYYYDPVDILPATEADLRIYSGPN
FT                   VTSTTPTWGEPFNVKVTVKNYGSEPMQLQELYIKLRGPNGEILDLGGDDNSNPIDPGEV
FT                   RTISKYVPRLAIDYPGLYGNYVLTVTYIDPGGFLAPGLPPGESSTSTSIPLTVVAPSYK
FT                   AQIYSITPDSPSYYEQTTGSLTVKLRNTGNATWYKNSSSIQNAVRLVTYNDAFHPSRFY
FT                   VEGSWLSSSRILMQDSLVMPGGIGTFRFKLNGDLPPGNYTEYFRLRVEGSFGSTYRGFF
FT                   GDQVAVNISVLDDSTPPSITINAPRYSTERSSELSFPISWQGNDEQTGVKDYDIYWKNG
FT                   TDYVPWKSATSSTSATFGNGDPINLAQGGNYLFRLRAEDIAGNVSSWRNFRVIVPFDDT
FT                   RFSYNSGWRSYYNPYARHYLHTYHYAYSYGRQATFSFYGRRVAWIGVKGPTRGMAEVWI
FT                   DGSRIATVDLYAPRYSTRTVVFEKSLGTRNARHTITIKVLGKRNQLSTSNRVDIDGIAV
FT                   LR"
     atgaaaaaca gcttagtagc tatatttgct actgctttac tatgcttgac agtactgacg        60
     actccttcgg tcaaagctgt tggtgactac ggtaatgtag aaggtagagt tacctacaac       120
     ggactgccag taaagggagc ctctatatca gccggtggac agtctgttat atcggactct       180
     cagggtagat ttagatttga tcccctacta gtacaagaca gctggcgagc tataaacgtt       240
     acagtcagag catcaggtct tggcgtttgg aggctataca atgcagtcat catccctaac       300
     gataccctaa ggttggatgt gaagttatca aagcacgatg tcacactttc tcagcccctt       360
     ccggggacca ccaaaaacaa cttagcaccg tcgaaggtct cacctgagca ggatcagaat       420
     ctcaaaccag cagccaccac tttgggctcc caaaaggtcc ccccaggagt gattagggtc       480
     tacgttactg acaagacagg actctcgccc gaagatatgt ggagctgtag atatgatcca       540
     gtacctaaag gtgaggttgt ggaggtacct ttcaaggact acgttaagca tgtcctccca       600
     aatgaatggt ttgctagttg ggacatggag tccctacgag ctggagccat ggcagtaaaa       660
     agttatgctt ggtactacgt gtccagaggg ggcaagtggt actggctggg agctgatgtc       720
     atggacacta cctgcgatca ggtatacaac ccagcggtca gttacgcgag cacagaccaa       780
     gcagtggaga atacctggta ccaaagacta accgagaatg gctatatagt ccccgctttc       840
     tacagagccg gcaccaaagg tgatccagga gagcaaggct ccgatgtcat gagccagtgg       900
     ggaagtcagt actgggctac caaaggtaag acttgggact ggatcctgca ttactactac       960
     gatcctgttg atatcttgcc agctacagaa gccgacctaa gaatctactc aggacctaac      1020
     gtgaccagca ccacccccac ttggggagag cctttcaacg tcaaagtgac cgtcaagaac      1080
     tatggcagcg aacctatgca gctccaagag ctctacatca aacttcgagg gcccaatggt      1140
     gagatactcg acctgggagg agatgacaac tccaacccca tcgacccggg agaagtgcgc      1200
     actattagta agtatgtacc aaggcttgca atagattacc ctgggctata cggcaactat      1260
     gtactaactg tgacctacat agatccaggt ggattcttag ctcctggact gccaccaggc      1320
     gagagctcca catctacatc tataccactt acagtggtag ctccgtctta caaggcccag      1380
     atctattcga taactcctga ttcccccagc tactacgagc agacaacagg aagcctgact      1440
     gtgaagctca gaaacacagg caacgccacc tggtacaaga acagctctag catccagaac      1500
     gcagttagac tagttacata taatgatgcc tttcacccga gcagatttta tgtggagggg      1560
     agttggttat catcctccag aatcctcatg caggattccc tggtcatgcc cgggggcatc      1620
     gggactttta ggttcaaact aaatggtgac ctaccaccag gaaactatac agagtatttc      1680
     aggcttagag tggaaggatc ttttggatcc acatacaggg gcttctttgg ggatcaagtt      1740
     gccgtgaaca ttagcgtcct tgatgactcc actcccccga gcattactat taatgcccct      1800
     agatactcta cagagaggtc ttcagaactg tcattcccta taagctggca gggtaatgac      1860
     gagcaaactg gtgtgaagga ctatgacatc tactggaaga atggaactga ctacgtaccc      1920
     tggaagagcg caacaagctc cacttcggcc acatttggca atggagatcc tataaacttg      1980
     gcacaaggag gtaactatct gttcaggctt cgggctgaag atattgcggg caacgtgagc      2040
     tcgtggagaa acttcagagt tattgtaccc tttgatgata cgagatttag ctacaactcc      2100
     ggctggcgca gctattacaa tccttatgcc cggcattatc tgcacaccta tcactacgct      2160
     tattcctatg gccgacaggc cactttctcc ttctatggac gcagagtggc atggatcggc      2220
     gtcaaaggac ccacaagagg catggccgag gtatggatcg atgggtccag gatcgcgacc      2280
     gtggacctct atgctccaag gtatagcacc aggacggtgg tatttgaaaa gtctttgggc      2340
     acccgcaacg ctcgacacac aataactatc aaggtgctgg gcaaacgcaa tcaattatca      2400
     acaagcaaca gggtcgatat cgacggtata gcagttcttc gctaa                      2445
//

If you have problems or comments...

PBIL Back to PBIL home page