(data stored in ACNUC7421 zone)

EMBL: CP001825.PE439

CP001825.PE439       Location/Qualifiers
FT   CDS_pept        484726..490083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0442"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: tcx:Tcr_1150 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: EAL domain protein; PAS fold-3
FT                   domain protein; GGDEF domain containing protein; GAF domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAC repeat-containing protein; GAF domain protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41363"
FT                   /db_xref="GOA:D1CEK7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ41363.1"
FT                   /translation="MIKEEVIETSQSDKLNSYEELKASLLKLAATAIRATGFQVILVNV
FT                   REGEGFRVITGTDDILLGTYTTFDFWNKLLKEEFRISQSYLVPPWHSRQVLQDVPDDMY
FT                   VIPDIPEAKSPEDWDPYHFLIVPLLDSKREVIGFFSVDEPVSGKVPSEDLIQDLETFAE
FT                   HAALAIEKFNLINELSDRVRQVDALYKVSKSINNFQDSEAALRFLVDTANELLHADFAV
FT                   LLVHEPAGDRAISTAEIDVETYDRLRRLSRELLSPEPTLYELHLADGTPSSRLIGVCVR
FT                   VGPEDGPMGVLGVFYQDENHPKDISYSILSSLAEQAFTALRNRHLYNAAVSRADRLRVI
FT                   QSIASRLNRLNDVRKIAKAISEELRQLVDFHACRIFLASDEYLVPAAVITDHSEYSPEE
FT                   VDNLRVGFGEGITGWVAQHGEPALLHDAAKDTRTRLIPGTNDIDESMLAVPIKYDDRVV
FT                   GVITLSKVGLNQFDNEDLQLLVILADQAAIAIENAKLVEKLSLEAEALRKSEERNQLIS
FT                   RATNDAIWDWDLSTNRIIWNDAIQRLFGYEADHEFETSIEWWEERCHPDDIERLRESLY
FT                   GAINSDADVWAEEYRFRKADGSYAYVLDRGYIVRDASGKAIRAVGSMLDITHRIEAAKA
FT                   LRESEERFKAIFEDSAIGMALIDQEGRILKTNKALTKILGYTQNDLIEKNFLELVHPDH
FT                   ESTLRGRFTRIFSGKNTHYHVEQRYIHKDGHEIWGNLTVSAIRSHSGDVDLAVCMLEDI
FT                   TSRKQADSRILFQARLLDQVPVAVIACDMQMRVVHWNSAASDLFGYTPQEAIGKEVFEL
FT                   ASTIDKSENIREVIQVVLREGSWRGEVDFPLEDRVVPAQVEISAVRDKRRMLVGLVAVI
FT                   VDLSDQKKVEERLRRQNVYLSALHEIALATMRRLDPSDVFRTLLTRAAPLFNEENGFVY
FT                   LEDDDTSKLRLWVGTGVFTDYENTWLEPGEGVSGRVWRTGKPVILKDYISWPHRARMFD
FT                   ELVFHAVMAVPIFLNGRSVGSLGFVSFTQGKVFSEDDLHLLHRLADLASIALENSRLYQ
FT                   QLEKELSERLKAEEELQARAKQQAAVAYLGQLALAEDDQDSLLRKAADTVADVLDVEYS
FT                   AILRDVDNGKTLVLEAGHGWPEGVIGSRLTAAREGHPPTPDKASFNIYPPEIRYLQSGV
FT                   IRSAISVGIGGQSSPYGLLCAYSLEPRIFSPDDINFLQSVSNILAAAIEYRRAAQDLMR
FT                   AEARYRKLVEQIPAVTYIEEMGMRGVVSYISPQVEDMLGYTPEEWTSNPDPWSRIIHPD
FT                   DYEDVATSMEKAEELGIPFRKEYRMISKSGEIVWVRDEAVIVRDAEGQPLFWQGVLVNI
FT                   TDKKKLEDKLAYQAFHDALTGLPNRALFMDRLKGALARAKRYNSCCAVLFLDLDRFKHV
FT                   NDSLGHQYGDQLLIEVGNRLLSVVRSADTVARRGGDEFTILLEPICELEYAKQVAERVI
FT                   KELEKPFLINGQELYISTSIGIALSNEYSDAEELIHNADVAMYWAKSRGRARYEVYDLS
FT                   MSTFTLEKLKLESELRRAVQREEFSLVYQPVVRLRDKEVVALEALLRWHHPERGLLLPD
FT                   QFLKELEDTGLIMPLTDWMLREVCRQHKEWQKRVAGELPLVSVNFTARQFQKATMLEDL
FT                   ASILQDMDVSPSCLQLEITETVAMDDAASTARTMKGLKDLGVKLALDDVGTGYSSLSYL
FT                   RKFPLDVLKVDRTFVMGLGVDPDSTAIVHALVMLAKSLGMLVTAEGVEKQVQVDALSTL
FT                   GCDLAQGYFFSRPMEPDRITDILVRHALR"
     gtgattaaag aggaagttat agagacctct caaagcgaca agttgaactc atacgaggaa        60
     cttaaggcta gtctgcttaa gttggctgct actgctataa gagctactgg gtttcaagta       120
     atcctggtaa acgtaaggga aggagaaggt ttccgggtta ttaccgggac agacgacata       180
     cttctgggaa cttacaccac atttgacttc tggaataagc ttctaaagga agagttcaga       240
     atcagtcagt cctacctggt gccaccatgg cactctcgtc aggtattaca ggatgtaccc       300
     gatgatatgt atgtaatacc tgacataccg gaagccaaga gtccagagga ctgggatccc       360
     tatcatttct tgatagtgcc tcttttggac agtaagcgag aggtcattgg tttcttctca       420
     gtagatgaac cagtaagcgg gaaggtccct agcgaggacc taatacaaga tctggaaact       480
     ttcgcggaac atgcagctct ggcgatagag aagtttaacc tcataaatga gctctcagac       540
     cgtgtaagac aggtagatgc cttatataaa gtatctaagt ctatcaataa ctttcaggat       600
     tcagaggctg ccctcaggtt cctagtagac actgccaatg aactgctcca tgccgatttt       660
     gcggtcctgc ttgttcatga acccgctggt gatcgtgcta tatccactgc cgagatcgat       720
     gtagagactt acgacaggct aagacgtcta tccagggagc tgctctctcc ggagccaacc       780
     ctgtatgaat tgcatttggc agatggaact ccatccagca ggctaattgg cgtgtgtgtg       840
     agggttgggc ctgaggatgg tccaatggga gtcctaggag ttttctacca agatgaaaac       900
     catccaaagg atataagcta ttctatactc tcatccctag cagagcaggc ctttacggct       960
     ttgcgaaaca ggcacctata taatgctgcc gtttcgagag cagataggct aagggttata      1020
     cagtctatag cttctcgctt gaatagattg aacgatgtta ggaagatagc taaggctata      1080
     tctgaggagc tgcgccaact ggttgatttc catgcctgcc gcatattcct ggcatccgat      1140
     gagtatctgg tacccgcagc ggtcataacg gaccattctg aatactctcc tgaggaggta      1200
     gacaacctaa gagtcggatt cggagagggg ataaccggtt gggtagcaca gcatggtgaa      1260
     cctgcattgc tccacgacgc cgctaaggat acccgcacgc ggctgatacc aggaacaaac      1320
     gatatcgacg agtcgatgct tgcagtgccc ataaagtacg acgacagagt agtgggcgta      1380
     atcaccctct caaaagtggg actgaatcaa tttgataacg aagacctgca gctcttggtc      1440
     atattggcag accaggctgc gatcgctatt gagaacgcca agcttgttga gaagcttagc      1500
     ttggaagctg aggccctacg taaaagtgag gagcgtaatc agctcataag cagggccacc      1560
     aatgatgcta tctgggattg ggatctctcc acaaacagaa ttatctggaa tgatgccatc      1620
     cagaggcttt ttggctacga ggctgatcac gagtttgaaa ccagcattga gtggtgggag      1680
     gaacggtgcc acccagatga catcgaaagg ttgagggaga gcctctacgg agctatcaat      1740
     tcggatgctg atgtgtgggc agaggagtac agattcagga aggcagatgg cagctacgct      1800
     tacgtgcttg accgcgggta tatagttcgc gatgcgagtg gcaaggctat aagggccgta      1860
     ggctcgatgc tggacattac tcataggata gaggctgcta aggcactgcg ggagagtgag      1920
     gagagattca aggctatatt tgaagattca gctataggta tggccctgat tgaccaggaa      1980
     ggacggatat taaagactaa taaagcattg accaaaatac tgggctacac ccagaatgac      2040
     ttgatagaga agaacttcct agagcttgtg cacccagatc acgagtctac tctaagaggt      2100
     aggttcactc gaatcttctc tggcaagaac actcactacc acgtagagca aagatatatc      2160
     cacaaagatg gacacgagat ttggggcaac ctgactgtgt ctgctattag atcgcactcg      2220
     ggtgatgtgg atctggctgt gtgcatgctt gaggatataa ctagcaggaa gcaagctgac      2280
     tctaggatcc tcttccaggc gaggctgttg gatcaggtgc ctgtggcggt gatagcctgc      2340
     gatatgcaga tgagggtagt acattggaac tcggcggcaa gtgacctgtt cggatatacc      2400
     cctcaggaag ctattgggaa ggaagtcttc gagcttgcct ccactataga taagagtgag      2460
     aacattcgag aagtgattca ggtagtgctt agggagggca gctggagagg tgaggtggat      2520
     ttcccactgg aagacagggt tgttcctgct caggtggaga tatcagcagt acgtgacaag      2580
     cgcaggatgc ttgtaggtct agtggccgta attgtcgatc tctccgatca gaagaaagtt      2640
     gaggagagac tacggaggca gaacgtgtac ctcagcgctc tccacgagat cgcactggct      2700
     accatgcgca ggctggaccc tagtgatgtt ttccgcaccc tgcttactcg tgctgctcct      2760
     ctcttcaatg aagaaaacgg ctttgtgtac ttagaggatg atgacaccag taagttgagg      2820
     ctctgggttg gcacgggtgt gtttacagac tatgagaata cctggctgga gcctggagaa      2880
     ggggtgtctg gacgcgtatg gcgtacaggt aagcccgtta ttctcaaaga ctacatctcg      2940
     tggcctcatc gtgccaggat gtttgatgaa ctagtcttcc atgctgtgat ggcagtgcca      3000
     atcttcctca atggtagatc tgttggctca ttgggattcg ttagctttac acagggcaaa      3060
     gtcttttctg aagacgatct ccatctatta cacaggttag ccgatttggc ttccatagcc      3120
     ctggagaatt cccggttata tcaacagctt gaaaaagagc taagtgaacg cctgaaggct      3180
     gaagaggaac tgcaggcaag ggcaaagcag caagcagctg tggcttattt gggccagtta      3240
     gcgctcgctg aagatgacca ggattctcta ttgcgtaaag ctgctgacac agtcgctgat      3300
     gttctggatg tggagtattc agcaatactg agggatgtag acaatggtaa gactcttgtc      3360
     ctggaggctg gacatggttg gccagagggt gtgatagggt ctcgtttaac agctgcgagg      3420
     gaaggacatc ccccgactcc cgataaggcc tcgttcaaca tatatccgcc tgagatccgt      3480
     tatctacaaa gtggagttat caggagtgcc atatcggtcg gcataggagg gcagagctcc      3540
     ccttatggcc tgctctgcgc atatagcctt gagcccagga tattttcccc ggacgatatc      3600
     aactttctcc aatccgtatc caacatattg gctgctgcta tagagtaccg aagggctgct      3660
     caggatctaa tgagggctga ggcaagatat agaaaactcg tggagcagat accagcagtc      3720
     acttatatag aagaaatggg gatgagggga gtggtctcct atataagtcc ccaagtagaa      3780
     gatatgcttg gctatacccc tgaggaatgg acaagtaacc ctgatccctg gtcgcgaata      3840
     atacatcctg atgattacga ggatgtggct acttctatgg aaaaagccga agagctgggg      3900
     atacctttta gaaaagaata taggatgatc tctaagagcg gtgagatcgt atgggtgcga      3960
     gacgaagcgg ttatagttag ggatgccgag gggcagcctt tgttctggca gggagttctc      4020
     gtcaatatta ccgataagaa gaagcttgag gataaacttg cgtatcaggc atttcatgat      4080
     gccctgacgg gactccctaa cagagcgctc tttatggatc ggctgaaagg cgcgcttgcc      4140
     agagccaaga ggtataactc ctgttgtgca gtgcttttcc tggatctaga taggttcaag      4200
     catgtcaatg acagtcttgg ccaccagtac ggagatcagc tcttgataga ggtaggcaat      4260
     cggttgttga gtgtagtccg ctctgcggac actgtagcac gccgaggtgg cgatgaattt      4320
     accatcctcc tggagcctat ctgcgagctg gagtacgcca agcaggtggc cgaaagggtt      4380
     ataaaggagc tggagaagcc gtttttgatc aatggtcaag agctctatat aagcaccagc      4440
     ataggtatag cacttagtaa tgagtactct gatgcagagg agcttataca taatgcagat      4500
     gttgctatgt attgggctaa gagtaggggg cgggcaaggt acgaagttta tgatcttagc      4560
     atgagcactt ttacattaga gaagctgaag ctcgagtctg agttgcgcag agctgtacag      4620
     cgggaagagt tcagcttagt gtaccagcct gtggtaaggc tgcgagataa ggaagtcgta      4680
     gcgcttgagg cgctgctgcg ctggcatcat ccagagaggg gacttcttct gccagatcag      4740
     ttccttaagg agctggaaga tacggggctc ataatgcctt tgaccgactg gatgctgcgc      4800
     gaggtgtgta ggcagcataa ggagtggcag aagcgagttg ctggggaatt gccgttggta      4860
     agcgtgaact ttactgccag gcagttccag aaagccacta tgctggagga cttggcaagc      4920
     atactccaag atatggatgt ttcaccctcg tgcctgcaac tggagataac ggagaccgta      4980
     gcgatggatg atgctgcttc tacagccaga accatgaagg ggctcaaaga cctgggagtt      5040
     aagctggctc ttgacgatgt agggactggc tactccagcc tgagctacct caggaagttc      5100
     cccctggatg tattaaaggt cgacaggact tttgttatgg ggctgggtgt agatcctgat      5160
     agtacggcaa tagtgcatgc acttgtaatg cttgcgaagt cgcttggcat gcttgtgaca      5220
     gctgaggggg ttgagaagca ggtccaagtt gatgctttaa gtactctggg ctgtgatctg      5280
     gctcaagggt acttcttttc cagacccatg gagcctgatc ggatcaccga tattttggtc      5340
     aggcatgctc tccgatag                                                    5358
//

If you have problems or comments...

PBIL Back to PBIL home page