(data stored in ACNUC7421 zone)

EMBL: CP001825.PE44

CP001825.PE44        Location/Qualifiers
FT   CDS_pept        complement(46948..47622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0045"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   sfu:Sfum_1786 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40968"
FT                   /db_xref="GOA:D1CDG2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG2"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACZ40968.1"
FT                   /translation="MAKDLILALDTSDRRCGLAINRNGENLLDLSWDSGRSHTVQLMPW
FT                   LDYAFKQLRLSKESISAVAVTTGPGSFTAMRVGMATAKGICKALGVPIIGVPTLLYAAW
FT                   PYRYFCKHIVACLVLGRGRLAAALYASEDGGNLSLQWCRSLSLQELANELDSLPYDRVL
FT                   LCGDIPVELKENLKDSTRYLLLSPAESSRRLAVLAEIAWQRFRLGSVDNPATLQAEYLD
FT                   RK"
     ttggcaaagg atctaatact tgctctggat acttctgatc gtagatgtgg attggctatt        60
     aaccgcaacg gtgagaattt gcttgattta tcctgggatt cgggcaggtc gcatactgtt       120
     caacttatgc cttggctaga ttacgccttc aagcaattga ggctctccaa ggagagcata       180
     tctgcggttg ctgtaactac tggtccgggg tcgttcactg ccatgagggt gggcatggca       240
     accgctaagg gcatatgtaa ggctctaggt gtacccatca taggcgtgcc tactctcctc       300
     tacgccgcat ggccctacag gtacttctgt aagcatattg tggcctgtct tgtgctaggt       360
     agaggtaggc tggctgctgc gctttatgca tctgaagatg ggggaaacct tagcttacaa       420
     tggtgcagga gtttatcctt gcaggagcta gctaacgaat tagattctct gccttacgat       480
     agggttctac tgtgtgggga tattccagtt gagttgaagg agaatctgaa agatagtact       540
     aggtatttgt tgctatcccc agcagagtct agcaggcgtc tggcagtcct tgctgagatc       600
     gcctggcaga gatttagatt ggggtctgtg gataatccgg ccactttaca agcggaatat       660
     cttgatcgta agtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page