(data stored in ACNUC7421 zone)

EMBL: CP001825.PE441

CP001825.PE441       Location/Qualifiers
FT   CDS_pept        491086..491370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41365"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41365.1"
FT                   /translation="MSYGYESTNLSDTAREIKQYIYDSTIYEKSPEPLKGDASWWADQT
FT                   GIPEEEIIPALEELVASNTLIKQEDDSNPVYIYVPMTVVSPELHGPTQE"
     atgagctacg gatacgagtc cacgaatctg agcgatacag ctcgggagat caagcaatac        60
     atatatgatt cgactattta cgagaagagc ccagagccac taaagggtga tgcatcctgg       120
     tgggccgacc agactggcat ccctgaagag gagataatcc cggctcttga ggagttggtt       180
     gccagcaata ccctgatcaa gcaggaggat gatagcaacc ctgtttacat ctatgtacct       240
     atgaccgttg taagtcccga gctgcatggc cctacgcaag agtag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page