(data stored in ACNUC7421 zone)

EMBL: CP001825.PE442

CP001825.PE442       Location/Qualifiers
FT   CDS_pept        complement(491848..493638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0445"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bsu:BSU01660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41366"
FT                   /db_xref="GOA:D1CEL0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ41366.1"
FT                   /translation="MVPTIKRLLMAICILVLIGISACQDVVYRGSAITHASSSSWAEAT
FT                   LSKMTLREKIGQMFAVYVYGDSAYDTDPWAVNANRKLYGVDNASQIIQKYHVGSIIYFT
FT                   WTGNIKNAQQVARLSNGIQRSSMTQRVPVPTLISTDQEGGIISRLPSQIVRSPGNMALG
FT                   AARDKTYAFRAAYIVGKELRALGINQNLAPDADVNINPFNPVIGVRSFGDRSWLVARLT
FT                   AAQVRGYQSVDVAATAKHFPGHGDTNIDSHTGLPVIRHTQKQLEDIDLPPFRAAIDSGV
FT                   DVIMSAHIVVPSLDPSGRPATLSKPILTGLLRQKLGFKGVIMTDSLEMAGVRQMFPDSR
FT                   VPVEAIKAGADLLLMPPDLNLAINSVVNAVERGEISVSRINASVLRILELKARLGLPAN
FT                   PYVDADSVSSHVKTHWHILSAADISNHTITIIRNSGVLPLKPNSGRTVLVTGWGDEPTI
FT                   EVAAKMSSYGVRVTRYSTGDHPSSSVRDHAVYLARQKSLVVVLTRDIQWDTRQRELVKS
FT                   LIQTGKPVIVLSVELPYDLAYVTSAKTYVATYSYNPVSLRAAVRVMFGKASPVGKLPVR
FT                   IPKANAPQETLYPFGYGLGY"
     atggtaccta ccatcaaaag actactgatg gctatttgca ttctcgtatt gataggaata        60
     tcagcttgcc aagatgtggt ctatcgagga agtgcgataa cccacgcatc atcctcaagc       120
     tgggcagagg ccaccttatc caaaatgacc cttagagaaa agatagggca gatgtttgca       180
     gtgtacgtct acggagatag cgcttacgac acagatccct gggcagtaaa tgcgaacagg       240
     aaactatacg gtgtggacaa cgcatctcaa ataatacaga agtatcatgt tggtagtatc       300
     atatatttca catggactgg gaacattaaa aatgcccagc aggtagcaag gttatcaaat       360
     ggtatccaaa gaagctccat gacccaaaga gtaccagttc ccacgctcat atctacggat       420
     caggagggag gcataatatc aaggttacct tctcaaatcg tccgttcccc tgggaatatg       480
     gcgctaggag ccgcaagaga caaaacgtac gcatttagag ccgcttacat agtcggcaaa       540
     gagctcagag ctctagggat caatcaaaac ttggccccgg atgctgacgt aaatatcaac       600
     ccattcaacc cagtgatagg tgtaaggtcc tttggggaca gatcatggct tgtggccaga       660
     ctaacagctg cgcaagtgag agggtatcaa agcgtcgacg tagcagcaac agccaaacat       720
     tttcctggac acggcgatac gaacatcgac agccatacag gactgcccgt tataaggcac       780
     acccagaagc agctggaaga tatagatctg cctcctttca gagctgctat cgattcagga       840
     gtcgacgtta tcatgagtgc ccacatagtc gtgccttcgc tagacccttc gggtaggcca       900
     gcaaccctct ccaaaccgat cctaacaggg ctactacgcc aaaaacttgg gttcaagggc       960
     gtaataatga cagattctct agagatggca ggggtccggc agatgtttcc ggatagcaga      1020
     gtgccagtgg aagctatcaa agctggagca gatctgctac ttatgcctcc ggatctaaac      1080
     ctagcgataa actcggtagt aaatgccgtg gaaagaggag agataagcgt ttctcgcata      1140
     aacgcttcgg tgctacgtat cctcgaactt aaggcgcgac tggggttgcc agcaaatccc      1200
     tacgtcgatg ccgactcggt aagcagccat gtcaagactc actggcatat ccttagcgcc      1260
     gctgatatct ctaaccacac catcactatc atccgcaatt cgggcgtgct tccactgaaa      1320
     cccaattcgg gtcgaacagt cttggtaact ggttggggag atgaacccac aatagaagta      1380
     gccgcaaaga tgtccagcta tggcgtaaga gtcacgaggt actccacagg ggaccaccca      1440
     tcttcgagcg tgcgtgacca tgcagtctac ctggcaaggc agaagagctt ggtagtcgtg      1500
     ctaactagag atattcaatg ggatactagg cagcgagagc ttgtgaaaag cctgatacag      1560
     acagggaaac cagtaatagt actctctgtt gagcttccgt atgatttagc ttatgttaca      1620
     agtgccaaga cctacgtggc gacctatagc tataaccctg tctctttgcg ggcagcggtg      1680
     agagtaatgt ttggaaaagc ttcacctgta ggcaagttgc ctgtacgcat tccaaaagcg      1740
     aacgcccccc aggagactct ttatccattt gggtatggcc tggggtacta g               1791
//

If you have problems or comments...

PBIL Back to PBIL home page