(data stored in ACNUC7421 zone)

EMBL: CP001825.PE443

CP001825.PE443       Location/Qualifiers
FT   CDS_pept        493826..494920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0446"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: lch:Lcho_3206 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41367"
FT                   /db_xref="GOA:D1CEL1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41367.1"
FT                   /translation="MDQTIRVGVVGLGFAGNVHTMAYKKIPGVEVVALAGLEEDRLQLM
FT                   GKEYSIPNLYSRWEDLVARSDLDAVSVCTPNYLHAHVAIAALESGKHVLCEKPLARNTE
FT                   EAQSMVDAALRNRRVLQTAFNHRQRGDIMILKQYIDSGTLGKIYYAKGYWMRRQGIPGL
FT                   GSWFTSKELSGGGPLIDLGVHVLDQLMFLLGEPEITTVSASTYAEFGHRGRGVRRSGLQ
FT                   KMFVGADFDVEDLATAFMRTEDGTTVCLEASWAVQADYDDDFGLDLYGTEGGAQMRVKR
FT                   YGWQDTLRIFTDHGDVPVTIAPQTWQGTGHQAVVENFIDAIRSGNWSAHAGHEGLRRVQ
FT                   IVEACYKSALEGREISLQSIRQNV"
     atggatcaga ctattagagt tggggtggtt ggtttaggct ttgctggtaa cgtacataca        60
     atggcctaca aaaagattcc cggtgtagag gtggttgccc ttgcaggact tgaggaggac       120
     cgcctgcagc tcatggggaa agagtactct atacccaact tgtactccag gtgggaggat       180
     ctagtcgcaa gaagtgatct agatgctgta agtgtgtgta cccctaacta cctgcatgcg       240
     cacgtagcca tagccgcact tgagagcggt aagcatgttc tgtgtgagaa gcctttggca       300
     cgcaatacgg aggaggctca gtcgatggtg gatgcagcgc tgcgcaatag aagagtgctg       360
     cagacagctt ttaaccatcg ccagcgtggt gacatcatga tcctcaagca gtatatcgac       420
     agtggaacgc taggcaagat ttactatgcc aaaggttatt ggatgcgtcg acagggtatt       480
     cccggtcttg ggtcatggtt cacaagcaaa gagttatctg gtggtgggcc tctcatcgat       540
     cttggagtgc atgtgttgga ccagctgatg ttccttctag gtgaaccgga aatcactacc       600
     gtcagtgcct cgacatatgc ggaatttggc cacagaggca gaggcgtacg taggagcggc       660
     cttcaaaaga tgtttgttgg agctgatttt gatgtggagg atctggccac ggcgtttatg       720
     cggacggagg atggaactac ggtttgcctt gaggccagct gggcagtgca agcagattat       780
     gatgatgatt ttggccttga tctatacggt actgaaggcg gtgctcagat gcgagtgaag       840
     cgttatgggt ggcaggacac tttgcgcata ttcactgatc atggggatgt tccagttact       900
     atagcacccc agacttggca gggtacaggg caccaagctg ttgtagagaa ctttatagat       960
     gccatacgca gtggtaattg gtctgctcat gctggtcatg agggattgag gcgtgttcag      1020
     atcgtagagg catgctataa atcggcgctt gagggcagag agataagctt acaaagcatc      1080
     aggcaaaatg tttaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page