(data stored in ACNUC7421 zone)

EMBL: CP001825.PE447

CP001825.PE447       Location/Qualifiers
FT   CDS_pept        499758..500822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:499809..499811,aa:Sec)
FT                   /locus_tag="Tter_0450"
FT                   /product="selenide, water dikinase"
FT                   /note="Contains selenocysteine; TIGRFAM: selenide, water
FT                   dikinase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ppr:PBPRB1545
FT                   putative selenophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41371"
FT                   /db_xref="GOA:D1CEL5"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL5"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ACZ41371.1"
FT                   /translation="MDDRERIRLTSLASCAGUAAKLGPGDLAQVLQPFTGRNTSNLLVG
FT                   LDVADDAAVYRLDEGQALVQTVDFFPPIVDDPYTFGAIAAANSLSDIYAMGGTPILALN
FT                   IAGWPGNLPLDMLAQIFRGGMDKVEEAGAVIGGGHTVMDQEPKYGLCVTGLIHPGKITT
FT                   KGAVKPGDLLVLTKPLGTGVITTALKSGKVRDVDIQAAVDSMLRLNKVASELAVELGIR
FT                   AMTDITGYGLLGHAFEMSEASNVCLNIELSKLPVLPGALDYIRQDIYPGGLNRNRSYLT
FT                   GEQDGRKKISYDNSIIVDENLVKLAMDPQTSGGLLIAVPQEQADEFTARAEQRGQSIWI
FT                   IGFASEGYGVRLLP"
     atggatgata gggaaagaat caggcttaca tctctagctt catgtgctgg ttgagcggct        60
     aagttaggtc ctggtgacct ggcgcaggtt ctgcagccat ttaccggtcg caatacttct       120
     aatctgctag tgggcctgga cgtggcagat gatgctgctg tctatcggct tgacgagggc       180
     caggctctag tacagactgt tgacttcttt cccccaatag tcgatgatcc ctatacgttt       240
     ggtgctatag ctgccgccaa ctccctcagc gacatatatg ctatgggcgg gactcctatt       300
     ctcgctctaa acatagctgg atggccaggc aatctgcctc ttgatatgct agcgcagata       360
     tttagaggtg gtatggacaa ggttgaagag gcaggtgcag tgataggtgg tgggcataca       420
     gttatggatc aggaacctaa gtacggcttg tgtgtgaccg gtttaataca tcctgggaag       480
     ataactacca aaggagctgt caaaccggga gacttgctgg tacttactaa gcctcttggc       540
     acaggagtga taactacagc tctgaagagt ggtaaggtta gggacgtaga catacaagct       600
     gcggtggata gcatgctgag gctaaataag gtggcgtctg agctagcagt tgagctaggt       660
     ataagagcta tgacggatat tactggctat ggtttgcttg gtcatgcatt cgagatgtcg       720
     gaagccagta acgtctgtct caatatagag ctatctaagc ttccagtcct gccaggtgcg       780
     ttggattata tcaggcagga catatatcca gggggactaa accgcaacag aagctacctt       840
     actggcgagc aagatggcag gaagaaaata agttacgata acagcattat tgtggacgag       900
     aacctcgtca agcttgctat ggatccccag acatctgggg ggttgctcat cgctgtgccc       960
     caagagcagg cagatgagtt tactgctcgg gctgagcaga gaggccagtc gatatggatt      1020
     ataggtttcg ccagtgaggg ctatggcgta cgtttgctcc cctga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page