(data stored in ACNUC7421 zone)

EMBL: CP001825.PE448

CP001825.PE448       Location/Qualifiers
FT   CDS_pept        complement(500798..501817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0451"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sus:Acid_2997 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41372"
FT                   /db_xref="GOA:D1CEL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41372.1"
FT                   /translation="MKWKNMLLAASTLGVVAGTAIRRRRELDLRGQVVLVTGSSRGLGF
FT                   LIAKAFAHEGCRVAICARNEEELEQARAQLESHGADAIAVKCDISDRDQVSAMVDTVTR
FT                   HFGRIDILVNNAGIMVVGPVQTMNTEDFQQAMDVMYWGMFYTTMAVLPQMIQRRAGRIV
FT                   NITSVGGKISVPRLLPYTAAKFAAVGFSEGLRAEMKKHGIYVITVVPGLMRTGSHLGAY
FT                   FKGKHKAEFTWFSLGASMPVVAMDAEVAARQIVEATRRGTSEKILSWPAHLIVRIHGLI
FT                   PGITTDMLGVINRLIPEDPNSKEKIKGEEILKMMGNSPIAKIISSLAQNTTQGSKRTP"
     atgaaatgga agaacatgct actggcggca tccacgcttg gggttgtcgc aggcactgct        60
     ataaggcgta gaagagagtt ggacctgagg ggacaggtgg tcctcgtaac aggaagctca       120
     agagggcttg gattcctgat agctaaagcg ttcgctcatg agggctgcag agtagcgata       180
     tgcgcccgga acgaggagga gctcgaacaa gctagagcac aactggagag ccatggagca       240
     gatgcaatag ctgtcaaatg cgatatttcg gatcgtgatc aggtaagcgc catggtcgat       300
     acggtgacca ggcactttgg aaggatagat atactcgtca acaacgcggg cataatggta       360
     gtcgggccag tacagactat gaatacagaa gatttccagc aggccatgga cgtaatgtac       420
     tggggcatgt tctacactac catggccgtg ctgccacaga tgattcagcg tagagcaggc       480
     agaatagtca atatcacatc tgtaggaggc aaaataagtg taccccgcct gctgccttat       540
     actgctgcta agttcgcagc agtaggcttc tcagagggtc tcagagcaga gatgaaaaaa       600
     catggcatct acgtgatcac ggtcgtacct ggactcatga ggactggttc acacttggga       660
     gcgtacttca agggtaaaca caaggccgag ttcacttggt tctcactcgg agcctcaatg       720
     cctgtagtgg ccatggatgc ggaagtagca gctcgacaga tcgtagaggc taccaggaga       780
     ggcaccagcg agaagatact ttcctggcca gcacatctga tagtaaggat tcatggactt       840
     ataccaggca taacaacaga tatgctcgga gtcatcaaca ggcttatacc agaagatcca       900
     aactcaaagg aaaagatcaa aggcgaagag atactaaaga tgatgggaaa ctctcccatt       960
     gccaagataa ttagctcctt ggcgcagaac acaactcagg ggagcaaacg tacgccatag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page