(data stored in ACNUC7421 zone)

EMBL: CP001825.PE449

CP001825.PE449       Location/Qualifiers
FT   CDS_pept        complement(501888..502667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0452"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bca:BCE_0194
FT                   3-ketoacyl-(acyl-carrier- protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41373"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41373.1"
FT                   /translation="MAERNLAGRIAIVTGATRRMGIGAAICRELAGRGADIAFTHWNDY
FT                   DRNMPWGGDEDGPGLLKTELESCGVRVLSIQADLSNPDSPKQILDQVEQELGPPSILVN
FT                   NAAYSINDGYEQLTAELLDAHYAVNMRAAILLSVEFARRFTLGEGGRIINMTSGQSLGA
FT                   MPKELAYIATKGAIEAFTRSLAPDVAPLGITVNAVNPGPTDTGWMSEELKCELLPRFPM
FT                   GRVGLPEDAARLVAFLASDDARWITGQVIHSEGGFLR"
     atggctgagc gaaaccttgc aggcaggata gccatagtga cgggagctac ccgaagaatg        60
     ggtatagggg cggccatatg tcgcgaactt gccgggcgtg gagctgacat tgccttcacc       120
     cattggaacg actacgatcg taacatgccc tggggaggag atgaagatgg ccctgggctg       180
     ctgaagaccg agttggagtc ctgtggtgtt agagttctca gcatacaggc agacttatct       240
     aatcctgact cccctaaaca gatactagac caggtcgagc aagagctagg ccccccttct       300
     atcctagtca acaacgccgc ttactccata aacgacggtt acgaacagct aaccgcagag       360
     cttcttgatg ctcattacgc ggtcaatatg cgtgcagcta ttctcctctc tgtggagttt       420
     gcaagacgct ttaccctggg cgaaggcgga agaatcataa atatgacctc agggcaatca       480
     ctcggtgcga tgcctaagga actagcctat atcgccacta agggggcaat agaagccttt       540
     accagatcgc ttgctccaga tgttgctcct ttaggaatca ctgtaaatgc tgtaaacccc       600
     ggaccaacag ataccggatg gatgagcgaa gaactcaagt gtgagctgtt accgaggttc       660
     cccatgggca gggttgggtt acctgaggat gccgcaaggc ttgtagcgtt cctggcatcc       720
     gacgacgcta ggtggattac cgggcaagtg attcattctg agggaggttt tctgcgctaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page