(data stored in ACNUC7421 zone)

EMBL: CP001825.PE45

CP001825.PE45        Location/Qualifiers
FT   CDS_pept        complement(47623..48147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0046"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   bsu:BSU05910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40969"
FT                   /db_xref="GOA:D1CDG3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG3"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACZ40969.1"
FT                   /translation="MLQQLDRLVLLTHNAEETKDLGRTLAQLVQPGDVIPLWGGFGVGK
FT                   TTFTQGLAEGLGVREAVVSPSFGLVNIYHSTKRPEITLYHLDLYRISSRQEAEGFGADE
FT                   LIMDEGVALVEWPEVIKDLLPPEKLDVNFEWIDENNRRITLAASGKRFLTLLTALEDKL
FT                   RQDKVAFDKES"
     atgctgcagc agttagatag gcttgtacta ctgactcata acgccgaaga gacgaaagac        60
     ttaggtagaa ctctagcaca gctagtgcag cctggcgatg tgataccact atggggtggt       120
     ttcggagtgg gaaagaccac ttttactcag ggcttggcag aggggctcgg agtacgagag       180
     gctgtagtta gtccgtcttt tggtctggtg aatatctacc acagtactaa aaggccggag       240
     ataacccttt atcacttgga cctatacaga ataagtagca ggcaggaagc agaaggattt       300
     ggagctgatg agctcataat ggatgaaggc gttgctcttg tagaatggcc tgaggtcata       360
     aaggatttgt tgcctccaga gaaattagat gtaaactttg aatggattga tgaaaacaac       420
     cgcaggataa cgcttgctgc tagtggtaaa aggttcttga cgctgctaac tgccctggaa       480
     gataaactca ggcaggataa agttgccttt gataaggaga gttag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page